(data stored in ACNUC7421 zone)

EMBL: CP000769.PE110

CP000769.PE110       Location/Qualifiers
FT   CDS_pept        complement(138216..139124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24330"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I4"
FT                   /protein_id="ABS24330.1"
FT                   /translation="MRLGRTAKTLLLAVAALAVAAAVAGGLRFKRYVDEDPRLCATCHQ
FT                   ASPEFALWMQGTHKSVACQRCHHARPEQGVAMLGAFLLGKAPAGHGGVEIGSCAECHFS
FT                   HDPRWPQVGGSRGHRIHYEEHKIACVRCHAASMHGFEPIAAKCADCHPGHAVRVHGMEG
FT                   MHCFACHEFLGDEPGLRPTRRDCLRCHTAQGIHAPVGEHGAPMAMACATCHRPHAPPGE
FT                   TLVSCTHCHDAPATRRAGLHANPGHFRCLDCHPAHTWTPEPARCLRCHAHAQSHAHGKS
FT                   CTACHEFGGAPRPPPRGESSP"
     atgaggctcg gacgcaccgc gaagacgctg ctcctcgccg tcgccgccct ggcggtcgcc        60
     gccgcggtcg ccggcggcct gcgcttcaag cgctacgtcg acgaggatcc gcggctgtgc       120
     gcgacctgcc accaggcgag cccggagttc gccctgtgga tgcagggcac gcacaagagc       180
     gtcgcctgcc agcgctgcca ccacgcgcgc ccggagcagg gcgtcgccat gctgggcgcg       240
     ttcctgctcg gcaaggcgcc ggcggggcac ggcggggtgg agatcggctc gtgcgcggag       300
     tgccacttct cgcacgatcc gcgctggccg caggtcggcg gctcgcgcgg gcaccgcatc       360
     cactacgagg agcacaagat cgcctgcgtc cgctgccacg ccgcgagcat gcacggcttc       420
     gagcccatcg cggcgaagtg cgccgactgc cacccgggcc acgcggtgcg ggtccacggc       480
     atggagggga tgcactgctt cgcctgccac gagttcctcg gcgacgagcc ggggctgcgg       540
     ccgacccggc gcgactgcct gcgctgccac acggcccagg gcatccacgc gccggtgggg       600
     gagcacggcg cgcccatggc gatggcctgc gcgacctgtc accggccgca cgcgccgccg       660
     ggcgagacgc tcgtctcctg cacgcactgc cacgacgcgc cggcgacccg ccgcgccggg       720
     ctgcacgcga accccggcca cttccgctgc ctggactgcc acccggccca cacctggacc       780
     ccggagccgg cgcggtgcct ccgctgccac gcgcatgccc agagccacgc gcacggcaag       840
     tcgtgcaccg cctgccacga gttcggcggg gcgccgcggc cgccgccgcg cggggagtcg       900
     tcgccgtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page