(data stored in ACNUC7421 zone)

EMBL: CP000769.PE114

CP000769.PE114       Location/Qualifiers
FT   CDS_pept        complement(143460..144239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_0445 membrane protein involved in
FT                   colicin uptake-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24334"
FT                   /db_xref="GOA:A7H6I8"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I8"
FT                   /protein_id="ABS24334.1"
FT                   /translation="MGPFELEGSPIAFAAAGLLVAVAFAFGVAASTEPAPARDVGARVA
FT                   YAECLHAGRGRTDCAPRREAALTLCAARRPVAECEALLAEADRGPERVVAEAEAARVAG
FT                   PLHGSPRRAAVGAAVALAALATVVALRRPRAASLARLAAGAMVGLALASVPALAAAAFG
FT                   VLVSAVVPRSEVALVGFGLFVATFAAVVGMPVAAGAADAPGAARRRRVHASLGVVAGGM
FT                   ALWIVLVGPIPAGAAGALQALSAVALALTGYLAPRPL"
     atgggaccgt tcgagctcga gggatctccg atcgcgttcg ccgcggccgg gctcctcgtc        60
     gccgtcgcct tcgcgttcgg cgtcgccgcg tcgaccgagc cggcgccggc gcgggacgtc       120
     ggcgcccgcg tcgcgtacgc ggagtgcctc cacgccgggc gcgggcggac cgactgcgct       180
     ccacgccgcg aggcggcgct cacgctgtgc gcggcgcgcc ggccggtcgc ggagtgcgag       240
     gcgctgctgg cggaggcgga ccgcgggccg gagcgcgtgg tggccgaggc cgaggcggcg       300
     cgcgtggcgg gaccgctcca cgggagcccg cggcgtgccg cggtgggcgc cgccgtggcg       360
     ctcgccgcgc tcgcgacggt ggtcgccctg cgccgcccgc gcgccgcatc cctcgcgcgg       420
     ctcgccgccg gggccatggt gggactcgcg ctcgcgtccg tgccggcgct cgccgccgcc       480
     gccttcggag tgctcgtctc ggccgtcgtg ccccgcagcg aggtcgccct cgtcggcttc       540
     gggctgttcg tggcgacgtt cgcggcggtg gtggggatgc cggtcgccgc gggggccgcc       600
     gacgcgccgg gcgccgcccg gcgccggcgg gtgcacgcga gcctcggggt ggtggcgggt       660
     gggatggcgc tctggatcgt gctcgtcgga cccatccccg ccggcgcggc gggcgcgctc       720
     caggcgctgt cggcggtcgc gctcgcactc accggctacc tcgccccgcg cccgctatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page