(data stored in ACNUC7421 zone)

EMBL: CP000769.PE130

CP000769.PE130       Location/Qualifiers
FT   CDS_pept        158374..159159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24350"
FT                   /db_xref="GOA:A7H6K4"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K4"
FT                   /protein_id="ABS24350.1"
FT                   /translation="MADDTTRAPRRGGGARAAVAWLAILALLGVVVWLVSERNARTWYL
FT                   VPDEGRLVVMRGVLAPIGRQTFKTADPVLAQAYEPIVAPPGKPLPEARGFEERSLLDQG
FT                   IYEIVSGWARDEIASGDPARLERGLGYLSRAERLAGLSAAQREDLSALRAESGFYEAQR
FT                   LLDRAVGELRQAAEKLRHTAASRSAHANDARALLHDVEPALDAAAVALRSAGGAPRPRT
FT                   GPPQPAQESQPAPQGATPAEPAPPAPAPAAPETGAAGER"
     gtggcggacg acacgacgcg ggcgccgagg cgcggtggcg gggcgagggc cgcggtcgcg        60
     tggctcgcga tcctggcctt gctcggcgtc gtggtttggc tcgtctcgga gcggaacgcg       120
     cgcacctggt acctcgtgcc ggacgaggga cggctggtgg tgatgcgcgg cgtgctcgcg       180
     ccgatcgggc ggcagacctt caagaccgcc gatccggtgc tcgcgcaggc ctacgagccc       240
     atcgtcgcgc cgcccggcaa gccgctgccc gaggcgcgcg gcttcgagga gcgcagcctc       300
     ctcgatcagg ggatctacga gatcgtctcc gggtgggcgc gcgacgagat cgcgagcggc       360
     gacccggcgc ggctcgagcg cgggctcggc tatctctccc gcgccgagcg gctcgccggg       420
     ctctcggcgg cgcagcgcga ggacctctcc gccctgcgcg ccgagtctgg cttctacgag       480
     gcgcagcggc tcctcgatcg cgcggtgggc gagctgcgcc aggccgccga gaagctccgc       540
     cacacggccg cctcccgctc ggcgcacgcg aacgacgccc gcgcgctcct gcacgacgtc       600
     gagccggcgc tcgacgccgc cgccgtcgcg ctgaggagcg ccggcggcgc gccgcgcccg       660
     cggacgggcc ccccccagcc ggcgcaggag agccagccgg cgccgcaggg ggcgacgccc       720
     gcggagcccg ccccgccggc gccggcgccg gcggcgcccg agaccggggc ggccggggag       780
     cggtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page