(data stored in ACNUC7421 zone)

EMBL: CP000769.PE132

CP000769.PE132       Location/Qualifiers
FT   CDS_pept        161999..162541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0134"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ade:Adeh_0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24352"
FT                   /db_xref="GOA:A7H6K6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6K6"
FT                   /protein_id="ABS24352.1"
FT                   /translation="MSVPRRYERIDIELPCRLFIPGEVGLRFEAFCTSQNLGLGGLFVT
FT                   SSFLLRAGLELYVELALPDGPLAIRSRIAHVVPHGDRAHPTGMGIEFLDVDAHGRETLL
FT                   RYFTPARYTSFYEAFIAEFPHLDETVPLRDVSLVLNLWEEWKIRGEGGPLSTASGAPPA
FT                   PALGEGTTDARGVRSRR"
     atgagcgtcc cccgtcgcta cgagcggatc gacatcgagc tcccctgccg tctcttcatc        60
     ccgggggagg tcgggctccg cttcgaggcg ttctgcacct cgcagaacct cggcctcggg       120
     ggcctgttcg tcacctcgag cttcctgctg cgcgccggcc tcgagctgta cgtggagctc       180
     gcgctccccg acggcccgct cgccatccgc tcgcgcatcg cccacgtcgt gccgcacggc       240
     gaccgcgctc accccacggg catggggatc gagttcctcg acgtcgacgc gcacggccgg       300
     gagacgctgc tccgctactt cacccccgcg cgctacacca gcttctacga ggcgttcatc       360
     gcggagttcc cgcacctcga cgagacggtg ccgctgcgcg acgtctcgct cgtcctgaac       420
     ctgtgggagg agtggaagat ccgcggcgag ggcgggccgc tctccaccgc ctcgggggcg       480
     ccccccgcgc ccgcgctcgg cgagggcacc acggacgccc gcggcgtgcg ctcgcgtcgc       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page