(data stored in ACNUC7421 zone)

EMBL: CP000769.PE144

CP000769.PE144       Location/Qualifiers
FT   CDS_pept        complement(175125..175733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0146"
FT                   /product="PE-PGRS family protein"
FT                   /note="KEGG: ade:Adeh_1681 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24364"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L8"
FT                   /protein_id="ABS24364.1"
FT                   /translation="MRRAPRRLQFSARAGRGGRARRRVPAGAGGSGGVRPTRGACGGAG
FT                   ARGHRRAARRPHARGAGSPGAERALRPAPPRGRPREVGTSHRGHARAPVRGARGDPRAG
FT                   RGARDAARGDAHRHHRRRPTGAAGRAARGGRGEGVVRERAGWTPDRPLDRGALGVWSGA
FT                   PPRRRAAARRRLGPEHGRAGQPRRRVISRRPRRRRGRRA"
     gtgcggcgtg ctcctcggcg gctccagttc tcggctcgcg ctggtcgtgg cgggcgcgct        60
     cgccgtcgcg tgccggcggg ggccggaggc tccggaggcg tccgccccac ccgaggagcg       120
     tgcggaggcg ccggagcccg aggccaccgc cgcgcagcgc ggcggccgca cgcccgggga       180
     gcaggctcac caggagccga gcgggcgctc cgaccggcac cgccgcgcgg ccgcccgcgc       240
     gaggtcggta cgtcgcatcg agggcacgct cgagcgcctg tccgaggagc gcgtggtgat       300
     ccgcgcgccg ggcgaggagc gcgtgacgct gcacgtgggg acgcgcaccg ccatcaccgt       360
     cgacggccga ccggggcggc tggtcgagct gcgcgagggg gccgaggtga gggcgtcgta       420
     cgcgagcggg cgggctggac gcccgaccgc cctctcgatc gaggcgcgct cggcgtctgg       480
     tcgggggcac cgccccggcg gcgggccgcc gcccgacgcc gtctgggtcc cgaacacggg       540
     cgagctgggc agccccggcg gcgggtgatc agtcgtcgtc cgcgtcgtcg gcgaggtcgg       600
     cgcgcgtga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page