(data stored in ACNUC7421 zone)

EMBL: CP000769.PE145

CP000769.PE145       Location/Qualifiers
FT   CDS_pept        175765..176700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24365"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6L9"
FT                   /protein_id="ABS24365.1"
FT                   /translation="MRRATSAGNAAPRLTRGPPRGLPPRGRAPHLLLMISTERPGEHLA
FT                   TRDREAGELDARADALRALSNAGVPHLVAGAYAFFEYTGIFRDTKDLDIFLRERDLEDA
FT                   FRVLEAAGFRTELLDPTWIGKGYRGEWFVDLIFSSGNGVAVVDDLWFEHARPGRVMGVD
FT                   VLLAPPEEIIWSKGYVLERERYDGADVNHLLRACGDSLDWDRLLQRFDRHWEVLFSHLM
FT                   LYRFTYPCERDKVPERVMHALMQRTRADMLEGNHVRPVCRGTLISRVQYRHDLEHLGYE
FT                   DGRALDEAERGGRTERDGGRGRDLPAGGDR"
     gtgcgccgcg cgacgtccgc gggcaacgcc gctccgcggc tgacccgggg gccgccccgc        60
     gggcttcctc cgcgggggcg cgcgccgcac cttctcctca tgatctcgac cgaacggccg       120
     ggggagcacc tcgcgacgcg ggaccgggag gcgggtgagc tcgacgcccg ggccgacgcc       180
     ctgcgcgccc tctcgaacgc cggcgtgccc cacctggtcg ccggcgccta cgccttcttc       240
     gagtacacgg ggatcttccg ggacacgaag gacctcgaca tcttcctccg cgagcgcgac       300
     ctcgaggacg ccttccgcgt gctcgaggcc gccgggttcc ggaccgagct gctcgatccg       360
     acctggatcg gcaagggcta ccggggggag tggttcgtcg acctcatctt ctcctccggc       420
     aacggcgtcg ccgtggtgga cgacctgtgg ttcgagcacg cccggcccgg gcgcgtgatg       480
     ggcgtggacg tgctgctcgc ccccccggag gagatcatct ggtcgaaggg ctacgtgctc       540
     gagcgcgagc ggtacgacgg cgccgacgtg aaccacctcc tgcgagcgtg cggcgactcg       600
     ctcgactggg accggctcct gcagcggttc gaccgccact gggaggtgct cttctcgcac       660
     ctcatgctct accgcttcac ctatccgtgc gagcgggaca aggtgccgga gcgcgtcatg       720
     cacgcgctga tgcagcgcac ccgcgccgac atgctggagg ggaaccacgt ccgcccggtc       780
     tgcaggggca ccctcatctc tcgcgtgcag taccggcacg acctcgagca cctcggctac       840
     gaggacgggc gggcgctgga cgaggccgag cggggcggaa ggacggagcg cgatggcgga       900
     cggggacggg accttccggc tggcggcgat cgctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page