(data stored in ACNUC7421 zone)

EMBL: CP000769.PE150

CP000769.PE150       Location/Qualifiers
FT   CDS_pept        180165..181049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0152"
FT                   /product="uncharacterised P-loop ATPase protein UPF0042"
FT                   /note="PFAM: uncharacterised P-loop ATPase protein UPF0042;
FT                   KEGG: ade:Adeh_0147 uncharacterised P-loop ATPase protein
FT                   UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24370"
FT                   /db_xref="GOA:A7H6M4"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6M4"
FT                   /protein_id="ABS24370.1"
FT                   /translation="MNELVNRGGPEVVILTGVSGSGKSTALRALEDAGFYCVDNLPILF
FT                   LEKLLELSGHTAGEVSRIALVVDAREGRFLADAPRVIQEIRQQGADVEVLFLDASDESL
FT                   VRRYSETRRRHPLAGESGTVPDGIAAERQALAALKAIADEVIDTTTLNVHELKRLVTRR
FT                   FATSEGARLGVTVVSFGFRFGLPTHADVVLDVRFLPNPYFIPELKPHPGTDPRVARFVL
FT                   GQPDAKAFLERISDLLGFLLPRYRAEGKSYLTIAIGCTGGKHRSVALAGALAERLEGGG
FT                   QPVRLWHRDVEKE"
     atgaacgagc tcgtcaaccg cggcggcccg gaggtggtga tcctcaccgg cgtgtccggc        60
     tcggggaagt ccacggcgct gcgcgccctc gaggacgcgg gcttctactg cgtcgacaac       120
     ctgcccatcc tcttcctcga gaagctcctc gagctgtccg gccacaccgc cggcgaggtc       180
     tcgcgcatcg cgctcgtggt ggacgcgcgc gagggccgct tcctcgccga cgcgccgcgc       240
     gtcatccagg agatccgcca gcagggggcg gacgtcgagg tgctgttcct cgacgcgtcg       300
     gacgagtcgc tcgtgcgccg ctactcggag acgcgccggc gccaccccct cgccggcgag       360
     agcggcacgg tccccgacgg catcgccgcc gagcgccagg ccctcgccgc gctgaaggcc       420
     atcgcggacg aggtcatcga cacgacgacc ctcaacgtgc acgagctgaa gcggctcgtg       480
     acgcggcgct tcgcgacgtc cgagggggct cggctgggcg tcacggtggt ctccttcggg       540
     ttccgcttcg ggctccccac ccacgccgac gtggtcctcg acgtgcgctt cctgccgaac       600
     ccgtacttca tcccggagct gaagccgcac ccggggaccg acccgcgcgt ggcgcgcttc       660
     gtcctcggcc agccggacgc gaaggccttc ctcgagcgga tctccgacct gctgggcttc       720
     ctgctcccgc gctaccgcgc cgaggggaag agctacctca ccatcgccat cggctgcacc       780
     ggcgggaagc accgctccgt cgccctggcc ggcgccctcg ccgagcgcct ggagggaggc       840
     gggcagccgg tgcggctgtg gcaccgagac gtcgagaagg agtag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page