(data stored in ACNUC7421 zone)

EMBL: CP000769.PE155

CP000769.PE155       Location/Qualifiers
FT   CDS_pept        183548..183820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0157"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: ade:Adeh_0152 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24375"
FT                   /db_xref="GOA:A7H6M9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6M9"
FT                   /protein_id="ABS24375.1"
FT                   /translation="MPRHERTFVIVNSLGLHARAAAQLVQTANRYRAEIHVEKDGMQVN
FT                   GKSIMGVLTLAAAKGSSIILVVDGEDADAAMTALAKVIESGFGET"
     atgccgaggc acgagcgcac cttcgtcatc gtcaactcgc tcgggctgca cgcgcgcgcc        60
     gcggcgcagc tcgtccagac ggcgaaccgc taccgcgccg agatccacgt cgagaaggac       120
     gggatgcagg tgaacggcaa gagcatcatg ggcgtgctga cgctcgcggc ggccaagggc       180
     tcctccatca tcctcgtcgt cgacggcgag gacgcggacg cggccatgac ggccctcgcg       240
     aaggtgatcg agagcgggtt cggggagaca tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page