(data stored in ACNUC7421 zone)

EMBL: CP000769.PE156

CP000769.PE156       Location/Qualifiers
FT   CDS_pept        183817..185616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0158"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein; KEGG: ade:Adeh_0153
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24376"
FT                   /db_xref="GOA:A7H6N0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N0"
FT                   /protein_id="ABS24376.1"
FT                   /translation="MTPSATSILVGIAASPGIAIGRCWPVDRRKVRAPKRLLAPEEIEN
FT                   ELARLRTALEISELQLAEVREKVERAPGTQGGAEHTAIIDMHRMMLKDEMLVLEAQRLI
FT                   REERVNAEWAVKRATRKIKSAFHEQADEYFKERRADVDYVGERVIKNLLGQAPDVEEPP
FT                   PEGAIIVAHDLSPADTALLLHERKVAAFVTDTGAKTSHTAIVARALEVPAVVGVGRITS
FT                   LAGRGDWIAVDGSRGVVVINPTPGERVEYEVARERFLEAEQVLLRTRDLPARTLDDVTV
FT                   RLAGNIEFVEEVPSLVAHGGEGVGLYRTEFLFIGRTELPGEGEQYQTYRRVLEALAPKP
FT                   VTIRTFDLGGEKLPVGMRLPAENPALGLRAIRYCLRQPEMFRAQLRALLRASVHGNLRI
FT                   MFPMISGVSELRAAKRLLAEVREELRREGAPVREEVPLGIMIELPSAALIADRLAEESD
FT                   FFSIGTNDLIQYAIGIDRQNKDVAYLYKPLHLAVLRMLKLICDAAQVKGIPVSMCGEMA
FT                   GDVMNTLVLIGLGVSELSMNGPAIPFVKRVVRAARAADGRALVERILSLTTADDIEREV
FT                   RTEMLRRFPELLEAEATFGPVSG"
     atgacgccga gcgccacctc gatcctcgtc ggcatcgccg cgtcgcccgg catcgcgatc        60
     gggcgctgct ggccggtgga tcggcgcaag gtccgcgcgc cgaagcgcct gctcgcgccg       120
     gaggagatcg agaacgagct cgcgcggctg cgcaccgcgc tggagatctc cgagctgcag       180
     ctcgccgagg tgcgcgagaa ggtggagcgc gcgcccggca cgcagggcgg cgccgagcac       240
     accgccatca tcgacatgca ccggatgatg ctgaaggacg agatgctcgt cctggaggcg       300
     cagcggctca tccgggagga gcgcgtcaac gccgagtggg cggtgaagcg cgcgacccgc       360
     aagatcaaga gcgcgttcca cgagcaggcg gacgagtact tcaaggagcg gcgcgcggac       420
     gtggactacg tgggcgagcg cgtcatcaag aacctgctcg gccaggcccc ggacgtcgag       480
     gagccgccgc ccgagggcgc catcatcgtc gcccacgacc tctcgcccgc cgacacggcg       540
     ctgctcctgc acgagcgcaa ggtggcggcc ttcgtgaccg acaccggcgc gaagacctcg       600
     cacaccgcca tcgtcgcccg ggcgctggag gtgccggcgg tggtgggcgt ggggcgcatc       660
     acctcgctcg cggggcgggg cgactggatc gccgtcgacg gcagccgcgg cgtggtggtg       720
     atcaacccca cgccggggga gcgggtcgag tacgaggtcg cccgcgagcg cttcctcgag       780
     gcggagcagg tcctgctccg cacgcgcgac ctccccgccc gcaccctcga cgacgtcacc       840
     gtccgcctcg ccggcaacat cgagttcgtc gaggaggtgc cgagcctcgt cgcgcacggc       900
     ggcgaggggg tggggctcta ccggaccgag ttcctgttca tcggccggac ggagctgccc       960
     ggcgagggcg agcagtacca gacctaccgg cgagtcctcg aggcgctcgc gccgaagccg      1020
     gtgaccatcc gcaccttcga cctcggcggc gagaagctgc ccgtcggcat gcgcctgccc      1080
     gccgagaacc ccgcgctggg cctgcgcgcc atccgctact gcctgcgcca gcccgagatg      1140
     ttccgggcgc agctccgggc cctgctgcgc gcgtcggtgc acggcaacct gcgcatcatg      1200
     ttccccatga tctccggggt gtccgagctg cgcgcggcga agcggctcct cgccgaggtc      1260
     cgcgaggagc tgcggcgcga gggcgcgccg gtgcgcgagg aggtccccct cggcatcatg      1320
     atcgagctgc cgtccgcggc gctcatcgcg gaccgcctcg ccgaggagag cgacttcttc      1380
     tccatcggca cgaacgacct catccagtac gcgatcggga tcgaccggca gaacaaggac      1440
     gtcgcctacc tctacaagcc gctccacctc gccgtgctgc gcatgctgaa gctgatctgc      1500
     gacgcggcgc aggtgaaggg gatcccggtc tccatgtgcg gggagatggc aggcgacgtg      1560
     atgaacacgc tcgtcctcat cggcctgggg gtctcggagc tctccatgaa cgggcccgcg      1620
     atcccgttcg tgaagcgggt ggtgcgggcg gcccgggccg cggacgggcg ggcgctcgtc      1680
     gagcgcatcc tctccctcac caccgcggac gacatcgagc gcgaggtgcg caccgagatg      1740
     ctccgtcgct tcccggagct gctcgaggcg gaggccacct tcgggccagt ctcggggtag      1800
//

If you have problems or comments...

PBIL Back to PBIL home page