(data stored in ACNUC7421 zone)

EMBL: CP000769.PE160

CP000769.PE160       Location/Qualifiers
FT   CDS_pept        complement(189630..190280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3781 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24380"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N4"
FT                   /protein_id="ABS24380.1"
FT                   /translation="MDRQRVAVVVALALAGLAAPVTASAGFVVGARVGWAFPFGELRNG
FT                   VDLDSAVRGQIPLQVDLGWRFADRLMLGGYARLSPGVVGDNVEDACDASSLDCDGPFGW
FT                   AVGGQVDVRLAPGNAGPWIGAFGGFEALTYGDVSEAVDTDSLELSYEGWEVGAQGGIDF
FT                   AWGPIVIGPWASVSWGRFTEISAEIGGRDTDIPEWDEATHTWVQVGLRGALDF"
     atggacaggc aacgggtggc ggtggtggtg gcgctggcgc tcgcggggct ggccgcgccg        60
     gtgacggcgt cggccggctt cgtggtgggc gcgcgggtgg gctgggcgtt cccgttcggc       120
     gagctgcgca acggagtgga cctcgacagc gcggtgcgcg ggcagatccc gctccaggtg       180
     gacctcggct ggcgcttcgc ggacaggctc atgctgggcg ggtacgctcg cctctcgccg       240
     ggcgtggtgg gggacaacgt cgaggacgcg tgtgacgcga gctccctcga ctgcgacggg       300
     cccttcgggt gggcggtggg gggtcaggtg gacgtccggc tcgcgcccgg gaacgccgga       360
     ccctggatcg gcgcgttcgg cgggttcgag gcgctgacct acggagacgt gagcgaggcg       420
     gtggacaccg actcgctcga gctctcgtac gaggggtggg aggtcggcgc gcagggcggg       480
     atcgacttcg cctggggtcc catcgtgatc gggccgtggg cgagcgtcag ctggggccgc       540
     ttcaccgaga tcagcgccga gatcggcggc cgagacaccg acatcccgga gtgggacgag       600
     gcgacccaca cctgggtcca ggtcgggctg cggggcgcgc tggacttctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page