(data stored in ACNUC7421 zone)

EMBL: CP000769.PE165

CP000769.PE165       Location/Qualifiers
FT   CDS_pept        194475..195434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0167"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: ade:Adeh_0161 ROK"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24385"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6N9"
FT                   /protein_id="ABS24385.1"
FT                   /translation="MPLGIGVDLGGTNARAAVVDADTGEIVAAHKEPLRDRTPAGVVEI
FT                   VRHAIGEATSAASVVPGVFGAVGVGVAGQCLGRTGVVLNAPNLGWRDIAFGELLRDALG
FT                   VPVRVANDLSVAAWGEKRFGAAKGIDDVVLVFVGSGVGSGLILDGRLYDGAQGVAGEFG
FT                   HVKVTPLRAETAVRRCGCGDWGCLEAYTSGVNVATRVREELAAGARTAIFERVGGDLAR
FT                   VTASLVDDAYRAGDAYARALWAEVGELLGTAIANLVTVLNPARLILGGGVLLGCPALGE
FT                   LVRRTFDAKVSKSAGKGLSIEHAWLGDDAGVIGAAVLP"
     atgccgctcg ggatcggcgt ggacctgggg gggacgaacg cgcgcgccgc ggtcgtggac        60
     gccgacacgg gcgagatcgt cgccgcgcac aaggagccgc tgcgggaccg caccccggcg       120
     ggcgtggtcg agatcgtgcg ccacgccatc ggggaggcca cctccgcggc gagcgtggtc       180
     ccgggtgtct tcggggcggt gggggtgggc gtcgcagggc agtgcctggg gcgcaccggg       240
     gtcgtgctga acgcgccgaa cctggggtgg cgcgacatcg ccttcgggga gctgctccgc       300
     gacgcgctcg gcgtgcccgt gcgggtcgcg aacgacctgt cggtcgcggc ctggggcgag       360
     aagcgcttcg gcgcggcgaa ggggatcgac gacgtggtgc tcgtgttcgt cggctccggc       420
     gtcggctcgg gcctcatcct ggacggccgg ctgtacgacg gcgcgcaggg cgtcgcgggg       480
     gagttcggcc acgtgaaggt cacgccgctg cgcgccgaga cggcggtgcg tcgctgcggc       540
     tgcggtgact ggggctgcct cgaggcctac acctcggggg tgaacgtggc gacgcgcgtg       600
     cgcgaggagc tcgccgccgg cgcgcgcacc gccatcttcg agcgggtggg tggagacctc       660
     gcgcgcgtga ccgcgagcct ggtggacgac gcttaccggg cgggcgacgc ctacgcccgg       720
     gcgctctggg cggaggtggg cgagctgctc ggcaccgcca tcgcgaacct cgtcaccgtg       780
     ctcaaccccg cccggctcat cctgggcggc ggcgtgctgc tcggctgccc cgccctcggg       840
     gagctcgtgc gccggacctt cgacgcgaag gtctccaagt ccgcggggaa ggggctcagc       900
     atcgagcacg cgtggctggg agacgatgcg ggcgtgatcg gcgccgccgt gttgccctag       960
//

If you have problems or comments...

PBIL Back to PBIL home page