(data stored in ACNUC7421 zone)

EMBL: CP000769.PE169

CP000769.PE169       Location/Qualifiers
FT   CDS_pept        197724..199214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0171"
FT                   /product="protein of unknown function DUF814"
FT                   /note="PFAM: protein of unknown function DUF814; KEGG:
FT                   ade:Adeh_0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24389"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P3"
FT                   /protein_id="ABS24389.1"
FT                   /translation="MSLGAGEIEAVVRELAPLVGSRVDAVRVHAERALTLELFGRAGPV
FT                   LLLLSAEPDVTRLHVTRARPPQPATPFPFQVLLRREIEGARLAAIETLPGDRVVALALE
FT                   TPRGRLRLVGELTGRHGNLFLLGDDGIIRASAGRNLSQRRKLVAGEPYVAPAPPPSPRV
FT                   ERPRFTAEPSGPFPLSAAVEARYAALVQERLVAEGRRRLREPVRAGVARASRALEKLAD
FT                   EAARVPVAEADRRAADLLKANLRAVKRGEREVTLTEWTEEGPREVRVALDPALAPQANM
FT                   ERLYRRYRRIVESAERVAARTAGVRGREAALRSLLGEIDSAPLEELPRLEREARRLGAG
FT                   PRPQPQPQPRPAGPGGRARARPEPLPYRVFRSAAGAAILVGRGAAENDRLTLRVARGND
FT                   LWLHARGVPGAHVVVRLEKGRGPDQGTLLDAAHLALHFSDARGAPQADVAYTRAKYVRK
FT                   PKGAGPGAVTYSQEKVLLLRTEPQRIARLLAEEEGGQE"
     atgtcgctcg gcgcgggtga gatcgaggcg gtcgtccggg agctcgcgcc cctcgtcggc        60
     tcccgcgtcg acgcggtgcg ggtccacgcc gagcgcgcgc tgaccctcga gctgttcggg       120
     cgcgccgggc ccgtgctcct cctcctctcc gccgagccgg acgtcacgcg cctccacgtc       180
     acgcgcgccc gcccgccgca gcccgccacg cccttcccct tccaggtgct gctgcgccgc       240
     gagatcgagg gcgcgcgcct cgccgcgatc gagacgctcc cgggggatcg ggtggtggcg       300
     ctcgcgctcg agacgccgcg cggccgcctg cggctcgtcg gggagctgac cggccggcac       360
     ggcaacctgt tcctgctggg cgacgacggg atcatccggg cgagcgccgg gcgcaacctc       420
     tcgcagcggc gcaagctcgt cgccggcgag ccgtacgtcg cgcccgcgcc cccgccttcg       480
     ccccgcgtcg agcggccgcg cttcacggcc gagccctcgg gcccgttccc gctctcggcc       540
     gcggtcgagg cgcgctacgc ggccctcgtg caggagcggc tcgtggcgga gggccgccgc       600
     cggctccgcg agccggtccg cgcgggcgtc gcccgcgcct cgcgcgcgct cgagaagctg       660
     gccgacgagg cggcgcgcgt gccggtcgcc gaggccgacc ggcgcgcggc ggacctcctc       720
     aaggcgaacc tccgcgcggt gaagcgcggg gagcgcgagg tgacgctcac ggagtggacg       780
     gaggaggggc cgcgcgaggt gcgcgtcgcc ctcgatcccg ccctcgcgcc gcaggccaac       840
     atggagcggc tctaccgccg ctatcggcgc atcgtggaga gcgcggagcg cgtggccgcg       900
     cggaccgcgg gggtgcgggg ccgcgaggcg gcgctccgct cgctcctcgg cgagatcgac       960
     tcggcgccgc tcgaggagct cccccgcctc gagcgcgagg cgcgccggct cggggcgggc      1020
     ccccggccgc agccgcagcc gcagccgcgc cccgccgggc ccggcggccg cgcgcgggcg      1080
     cgcccggagc cgctccccta ccgcgtcttc cgctccgccg ccggcgccgc catcctcgtc      1140
     ggccgtggcg ccgccgagaa cgatcgcctc acgctccggg tcgcgcgcgg caacgacctc      1200
     tggctgcacg cccgcggtgt ccccggcgcg cacgtggtgg tgcggctcga gaagggccgc      1260
     ggccccgacc aggggacgct cctcgacgcc gcccacctcg ccctccactt ctccgacgcg      1320
     cgcggcgccc cgcaggcgga cgtcgcgtac acacgcgcga agtacgtccg caagcccaag      1380
     ggcgcaggcc cgggcgcggt gacgtacagc caggagaagg tcctgctgct ccgcacggag      1440
     ccgcagcgca tcgcgcggct gctggcggag gaggagggcg gccaggagta g               1491
//

If you have problems or comments...

PBIL Back to PBIL home page