(data stored in ACNUC7421 zone)

EMBL: CP000769.PE170

CP000769.PE170       Location/Qualifiers
FT   CDS_pept        199319..200107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24390"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P4"
FT                   /protein_id="ABS24390.1"
FT                   /translation="MPPSVGSRPPVPRPPQANRQLELFDARRASREARLSAASRLADSL
FT                   SGILSERVRLTVHDNRSTMVSFRRGSGGIHYRLHHMFLGAPGEVVRALAAFAGPTRGAS
FT                   ARRREAGSRIDAFVRHNRARIAVPRADRLQPRGRAHDLQQIFDRLNAAHFGDAIQAHIG
FT                   WGAVRGGARRRTVKTGVYVQDARIIRIHPTLDRPEVPEFYVALVVFHEMLHQAVPAREV
FT                   NGRRVVHGAEFRRRERAYPDYARAKAWEEGNLGLLLSSPT"
     gtgcccccct ccgtaggatc gcggccgccc gtgccccgcc ccccgcaggc caaccgccag        60
     ctcgagctct tcgacgcgcg ccgcgcctcg cgcgaggcgc ggctctcggc ggccagccgg       120
     ctcgccgact ccctgtccgg catcctctcc gagcgcgtgc gcctcaccgt tcacgacaac       180
     cgctcgacca tggtgtcgtt ccgccgcggc tcgggcggga tccactaccg gctccaccac       240
     atgttcctcg gcgcccccgg ggaggtggtg cgggcgctcg ccgccttcgc cggccccacc       300
     cgcggcgcgt cggcgcgccg gcgcgaggcc ggctcgcgca tcgacgcctt cgtccggcac       360
     aaccgcgcgc ggatcgcggt cccgcgcgcc gaccggctcc agcctcgcgg gcgcgcccac       420
     gacctgcagc agatcttcga tcgcctcaac gcggcccact tcggcgacgc catccaggcg       480
     cacatcggct ggggggccgt ccgcggcggg gcgcgccgcc gcaccgtgaa gacgggcgtg       540
     tacgtgcagg acgcgcgcat catccgcatc caccccacgc tcgatcgacc cgaggtcccc       600
     gagttctacg tcgcgctggt ggtgttccac gagatgctcc accaggcggt gccggcgcgc       660
     gaggtgaacg ggcgccgcgt ggtgcacggc gcggagttcc ggcggcggga gcgcgcctac       720
     ccggactacg cgcgcgcgaa ggcctgggag gagggaaacc tgggcctgct cctctcgtcg       780
     cccacgtaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page