(data stored in ACNUC7421 zone)

EMBL: CP000769.PE171

CP000769.PE171       Location/Qualifiers
FT   CDS_pept        200232..202253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0173"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: ade:Adeh_0164 surface
FT                   antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24391"
FT                   /db_xref="GOA:A7H6P5"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P5"
FT                   /protein_id="ABS24391.1"
FT                   /translation="MVRRVALALLVPLALGATGCLRARGTESEPIVTELKLEGVEALDA
FT                   EDIKAKLATQEPAAPGGVTGLVRREGFPLDPDALASDRRRVEAFYRDRGYYAARVDKVD
FT                   VVPDGPGRARVVMHVVEGKPVRVTELHIKGLEEVAEARERLKELPLEVGDVFRVSAYDA
FT                   TKAAITRGLRTKGWANAEVTQAAQVLPQEGTAQVTYEVKAGRRFRFGPIFVAGTSAVSR
FT                   DLVREQASVDVRTGAWFDESKLSKAQARVFNLGVFAGVRVTRGTPSAERGIIPVVVAVR
FT                   EAPFRTIRAGPGLGVEATRWEARGNASWQHRNLFGELRRFGIDLRAGYAWLPTPWADQR
FT                   SGVVALIGFEFQQPAAIARRLDVSARVEVERGLELAYGFWAERVELGLPVRISPRWTFI
FT                   PSYNLEVYQLSDAPEAVVTRPGTPEAETRPLLVGCPSSTCLLSYLEQRLAWDGRDDAVN
FT                   TRRGYYVGLSLQEGFRIGTVGYRYLRFLPEVRGFWPLSRKLVLGARARVGALVPLTEPK
FT                   EPPIVANFYSGGPLSMRGYYTRRLSPMIEVGKNDWVPVGGNGLFDGSLELRYALAGNWS
FT                   GAWFLDAGNVAPPDNGETAWREALSLGDLQLASGVGLRYATPFGPIGVDVGVRLPTDLS
FT                   SGVPFDKRFPPVPSNPNAGTAEHREPIVAVHITIGEAF"
     atggtgcgcc gcgtcgctct cgcgctgctc gtcccgctcg cgctcggcgc caccggctgc        60
     ctgcgcgccc gcggcacgga gagcgagccg atcgtgaccg agctgaagct cgagggcgtg       120
     gaggccctcg acgccgagga catcaaggcg aagctcgcga cgcaggagcc ggccgcgccg       180
     gggggcgtca cggggctcgt caggcgcgag ggtttcccgc tggatccgga cgccctcgcg       240
     tccgatcggc ggcgcgtcga ggcgttctac cgcgaccgcg gctactacgc ggcgcgcgtc       300
     gacaaggtcg acgtggtgcc cgacgggccc gggcgcgccc gcgtggtgat gcacgtggtg       360
     gaggggaagc cggtccgggt gaccgagctg cacatcaagg ggctggagga ggtggccgag       420
     gcgcgcgagc ggctgaagga gctgccgctc gaggtcgggg acgtcttccg cgtgtcggcc       480
     tacgacgcga cgaaggcggc catcaccagg gggctgcgca cgaagggctg ggcgaacgcg       540
     gaggtgacgc aggccgccca ggtgctgccg caggagggga ccgcgcaggt gacgtacgag       600
     gtgaaggcgg gtcgccgctt ccgcttcggc ccgatcttcg tggcggggac ctcggcggtc       660
     tcgcgcgatc tcgtgcgcga acaggcctcg gtggacgtga ggaccggtgc ctggttcgac       720
     gagtcgaagc tctcgaaggc gcaggcgcgc gtgttcaacc tgggcgtctt cgccggggtg       780
     cgcgtgaccc gcggcacgcc cagcgcggag cggggcatca tcccggtggt ggtggcggtg       840
     cgcgaagctc cctttcgcac catccgcgcc gggcccggcc tcggggtgga ggcgacgcgc       900
     tgggaggcgc ggggcaacgc gtcgtggcag caccgcaacc tgttcggcga gctgcggcgg       960
     ttcgggatcg acctgcgggc cggctacgcc tggctgccca cgccgtgggc cgaccagcgc      1020
     agcggcgtcg tcgcgctgat cggcttcgag ttccagcagc ccgccgccat cgcccgccgc      1080
     ctcgacgtgt ccgcccgggt ggaggtcgag cgcgggctcg agctcgccta cgggttctgg      1140
     gcagagcggg tcgagctcgg cctccccgtc cggatctccc cgcgctggac gttcatcccc      1200
     tcctacaacc tcgaggtgta ccagctctcc gacgcgcccg aggcggtggt gaccaggccc      1260
     ggcacgccgg aggccgagac ccgcccgctc ctcgtcggct gcccgagcag cacctgcctc      1320
     ctctcctacc tggagcagcg cctcgcctgg gacgggcgcg acgatgccgt gaacacccgg      1380
     cgcggctact acgtcgggct ctcgctgcag gagggcttcc gcatcgggac cgtcggctac      1440
     cgctacctgc gcttcctccc cgaggtgcgc gggttctggc ccctctcgcg gaagctcgtg      1500
     ctcggcgcgc gggcgcgggt gggcgcgctc gtcccgctca ccgagccgaa ggagccgccc      1560
     atcgtcgcga acttctactc gggcggcccg ctctcgatgc gcggctacta cacccgccgc      1620
     ctctccccga tgatcgaggt gggcaagaac gactgggtgc cggtcggcgg caacgggctc      1680
     ttcgacggct cgctcgagct gcgctacgcg ttggccggga actggtccgg cgcgtggttc      1740
     ctcgacgccg ggaacgtggc gccgccggac aacggggaga ccgcctggcg cgaggccctc      1800
     tcgctcggcg acctccagct cgcgagcggg gtcggcctcc gctacgcgac cccgttcgga      1860
     ccgatcggcg tcgacgtggg ggtgcggctg ccgaccgacc tctcgtccgg ggtccccttc      1920
     gacaagcgct tcccgccggt gccctcgaac ccgaacgccg ggactgcgga gcaccgtgag      1980
     ccgatcgtcg ccgttcacat caccatcggc gaggcgttct ag                         2022
//

If you have problems or comments...

PBIL Back to PBIL home page