(data stored in ACNUC7421 zone)

EMBL: CP000769.PE172

CP000769.PE172       Location/Qualifiers
FT   CDS_pept        202253..206770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0174"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   ade:Adeh_0165 protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24392"
FT                   /db_xref="GOA:A7H6P6"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P6"
FT                   /protein_id="ABS24392.1"
FT                   /translation="MRALVAALRVAGWGLLGLVALVGVLLSAVTLFATSKAGGPIVARE
FT                   VIRLVDDALAGRFELAGVAVRPDGTVEVRGLRVFDPDEHLVLAVDRARVAIDVTQLRRR
FT                   TVGAAIALDGPSVLLEEEEDGGLSLVRAFSAAHPGPPRPEGPRTPPRGPGLEVRVSALA
FT                   IRGGDVWWVDADGATRLEARDLDLDARGAWQRSAADVELRLRGMLDLPVAAPLSLDVVA
FT                   SREGDRVRAPLLRASVGGTAVSLIGHLDVVTLAGRAAITRLDVDRAQARTVVPELGGGE
FT                   DAAATVYAESDGAIATAAARVEPRDGGPALGRRADAAVALRLDGARALGFDLALERLDP
FT                   SALHAAAPAGDVTLTGRGALVGSSLEDLRADVAVSVARSRLRRGELGPGEVVARAERGA
FT                   YDVRRLTLRAPGLSLDGALRWRPGGAVSGRVDADAADLGVAMRNLGALLGKELPDLRGS
FT                   ARVEAALSGTERAPVARATVSAPALRSGGLAVGGVKLDVSAEGPLRRPTVSVEGVVAAL
FT                   RSGGDEIARGLVLRARLADEEAVVSASAALPAVGDRPFALDARGRLGPRRDRLALAQLA
FT                   IAYPGARWTLTHPAELRFAGPSVDRLELVADAQRIALEGGLTPRGGLDAHAKLVGVDLT
FT                   RLPPGVIPRNLGVAGLVSADARAGGTRRRPLLDASFDFRGGAVRGLAGLDGAGTARWDG
FT                   RARRAAVTLGVARADGGSVDLSADLPIPLDRSPAAPLAARVRGRALPVAPVLAAAGAAS
FT                   PLQGTVELDAALEGTVGAPRVRADATLAEGAYEDLGPFAIAIALEDAGERAELRASAAY
FT                   DGVRALVLEAAAPLDLSEVIAGPSEALAALRGAPVEANVAVPGLELAPLAGVRGIPAGL
FT                   EGTLEVRAALAGTIDAPRGSIAVGLARGVVAGYRDVSAGLAVALEDARVALTGQVALGG
FT                   DPVLRLGGALEAPPERLLPADRLERTPLQLEVVVPRVQLARAAGADSTLPLAGTVEGRL
FT                   SASGTLAAPVARVELAGSGVAVAGRPLGEVSVRAEHANARTRAQAAIRAVAGGVVELSG
FT                   TLEAAFGVGVRGPPLREAPLDARLVARGLDLGVLAALLPGVVRSAAGPLTADVTAHGPL
FT                   GRPRPRGKVTLTDGRLAVAEYGEWTAIALDAEVNDDTLELRTLSARRGHGTVRVWGAAR
FT                   ALREQSSPVEAHVEARSLVIPRSGQELATIDVRGDATGTYAPDALRLEVKIPEGTLKLP
FT                   RQTPRELQQLEQRPDIVVGKPKTDERRRRSGAGAGPGAKPFVLAVHAMAPGRLFVKSDD
FT                   PPMNVELKADVTYELAGGNDYTSGEISVVRGFVEPIGGRHFELGRGRVQFTGGPPAAAM
FT                   LDVEATYENPEATVTVTVTGPAREPEIRLSSKPPLDEGQIAMLIATGRTEVKSGSGDSS
FT                   AFTGEEVGRAALGAVATRAFKNLVADKLPLDTVAVDSGAVRAGKYVTDKIYVGYVRRFD
FT                   ADVERGENENEARIEYRITPRWTAESRYGTSGSGGASLVWSKSY"
     gtgcgcgcgc tggtcgcagc gctcagggtc gcggggtggg gcctgctcgg cctcgtcgcg        60
     ctcgtcggcg tcctgctctc tgccgtgacg ctgttcgcga cctcgaaggc gggcgggccg       120
     atcgtggcgc gcgaggtgat ccggctcgtc gacgacgcgc tcgccggccg gttcgagctc       180
     gcgggcgtgg cggtgcggcc cgacggcacc gtggaggtgc ggggactgcg cgtgttcgat       240
     cccgacgagc acctcgtcct ggcggtggac cgggcgcgcg tggcgatcga cgtgacccag       300
     cttcgccgcc gcaccgtcgg cgccgcgatc gcgctcgacg gtccgtccgt gctcctcgag       360
     gaggaggagg acggcgggct gtcgctcgtg agggccttct cggccgcgca ccctgggccg       420
     cccaggccgg aggggccgcg aacccctccg cgaggcccgg ggctcgaggt gcgcgtcagc       480
     gcgctcgcca tccgcggcgg ggacgtgtgg tgggtcgacg cggacggcgc gacgcgcctc       540
     gaggcgcggg atctcgacct cgacgcccgc ggcgcgtggc agcgctccgc cgcggacgtc       600
     gagctccggc tgcggggcat gctggacctg ccggtggcgg cgcccctgtc gctcgacgtg       660
     gtcgcctcgc gcgagggcga ccgcgtgcgc gcgccgctcc tgcgcgcctc cgtgggtggg       720
     acggcggtct cgctgatcgg gcacctcgac gtggtgaccc tcgccgggcg cgccgccatc       780
     acccggctcg acgtcgaccg agcgcaggcg cgcacggtcg tgccggagct cggcggcgga       840
     gaggacgcgg cggccacggt ctacgcggag tcggacggcg cgatcgccac cgcggccgcg       900
     cgcgtggagc cgcgcgacgg cgggcccgcg ctcgggcggc gcgcggacgc cgcggtggcc       960
     ctccgcctcg acggcgcgcg tgcgctcggc ttcgacctcg ccttggagcg gctcgatccc      1020
     tccgccctgc acgcggccgc gccggcggga gacgtcaccc tcaccgggcg gggtgcgctc      1080
     gtcggcagct cgctcgagga tctccgggca gacgtggcgg tgtcggtggc ccgctctcgg      1140
     ctccgccggg gcgagctcgg gccgggcgag gtcgtcgcgc gcgccgagcg gggcgcgtac      1200
     gacgtccgcc ggctcacgct ccgcgccccc gggctctccc tcgacggcgc gctgcgctgg      1260
     cgccccggcg gcgccgtctc cgggcgggtg gacgccgacg cggccgacct cggggtggcg      1320
     atgcgcaacc tgggcgcgct gctggggaag gagctgcccg acctccgagg gagcgcgcgg      1380
     gtcgaggcgg cgctctcggg caccgagcgg gcgccggtgg cgcgcgcgac ggtgtccgcg      1440
     ccggcgctcc gctcgggcgg gctcgcggtg ggaggggtga agctcgacgt cagcgccgag      1500
     gggccgcttc gccgtccgac cgtgagcgtc gagggggtgg tcgcggcgct gcgctccggc      1560
     ggcgacgaga tcgcgcgcgg gctcgtcctg cgcgcgcggc tcgccgacga ggaggccgtc      1620
     gtgtcggcct ccgcggcctt gccggcggtg ggcgaccggc cgttcgccct cgacgcccgc      1680
     ggacgcctcg ggccgcggcg cgatcggctc gcgctcgcgc agctcgcgat cgcctacccc      1740
     ggcgcccgct ggacgctgac gcaccccgcg gagctacgct tcgccggccc ctccgtggac      1800
     cggctggagc tcgtggcgga cgcgcagcgg atcgcgctcg agggaggcct cacgccgcgc      1860
     ggcggcctcg acgcgcacgc gaagctcgtg ggggtggacc tgacccgcct gccgcccggc      1920
     gtcatcccgc gcaacctcgg cgtggccggg ctcgtgagcg cggacgcgcg cgcggggggc      1980
     acgaggcgcc gccccctgct cgacgcgagc ttcgacttcc gcgggggcgc ggtgcgcggc      2040
     ctcgccggcc tcgacggcgc cggcaccgcg cgctgggacg gccgcgcgcg ccgcgccgcg      2100
     gtcaccctcg gggtggcgcg cgccgacggc ggctcggtgg acctctccgc cgatctcccc      2160
     atccccctgg atcgctcgcc ggccgcgccg ctcgccgcgc gggtccgcgg gcgcgcgctg      2220
     cccgtcgcgc ccgtcctcgc cgccgcgggg gccgcctctc cgctccaggg gaccgtcgag      2280
     ctcgacgcgg cgctggaggg gacggtcggg gcgccgcgcg tgcgtgcgga cgcgacgctc      2340
     gcggaggggg cgtacgagga cctcgggccg ttcgcgatcg cgatcgcgct cgaggacgcc      2400
     ggggagcggg ccgagctgcg cgcgagcgcg gcgtacgacg gcgtgcgcgc gctcgtgctc      2460
     gaggcggccg cgccgctgga cctgtcggag gtgatcgccg gcccctcgga ggcgctcgcg      2520
     gcgctgcgcg gggcgccggt ggaggcgaac gtcgcggtcc ctggcctcga gctcgccccg      2580
     ctcgcgggcg tgcgcgggat ccctgcgggg ctcgagggca ccctcgaggt gcgcgcggcg      2640
     ctcgcaggca cgatcgacgc gccgcgcggg agcatcgcgg tcggcctggc ccgtggagtg      2700
     gtggcgggct accgcgacgt gagcgcgggc ctcgcggtcg ccctcgagga cgcccgggtc      2760
     gccctcacgg gccaggtcgc gctgggaggg gatccggtgc tgcggctggg gggcgcgctc      2820
     gaggcgcccc cggagcggct cctcccggcg gatcgcctgg agaggacgcc cctccagctc      2880
     gaggtggtgg tgccgcgcgt tcagctcgcg cgggcggcgg gcgcggactc gacgctcccg      2940
     ctcgcgggca ccgtcgaggg ccgcctgtcg gcgtcgggta cgctcgccgc cccggtcgcg      3000
     cgggtcgagc tcgcgggcag cggcgtcgcc gtggccgggc gccccctcgg cgaggtgtcg      3060
     gttcgcgccg agcacgcgaa cgcgcgcacc cgggcgcaag cggccatccg cgcggtcgcg      3120
     gggggcgtcg tcgagctgtc ggggacgctg gaggcggcgt tcggggtggg cgtgcgcggt      3180
     ccgccgctgc gggaggcacc cctcgacgcc cgcctcgtgg cccgcgggct cgacctcggg      3240
     gtcctcgccg cgctgctccc gggcgtggtg cgcagcgccg ccgggccgct caccgccgac      3300
     gtgacggcgc acggtccgct cgggcggccg cggccccgtg gcaaggtgac gctgaccgac      3360
     ggacggctcg ccgtcgcgga gtacggcgag tggacggcca tcgcgctcga cgcggaggtg      3420
     aacgacgaca ccctcgagct ccgcaccctg tccgctcgcc gggggcacgg cacggtccgc      3480
     gtgtgggggg ccgcccgcgc cctgcgggag cagagctcgc cggtggaggc ccacgtcgag      3540
     gcgagatcgc tcgtgatccc ccggtccggc caggagctcg cgaccatcga tgtccgcggg      3600
     gacgccaccg ggacgtacgc ccccgacgcg ctgcgcctcg aggtgaagat ccccgagggc      3660
     acgctgaagc tccctcggca gactccgcgc gagctccagc agctggagca gcggccggac      3720
     atcgtggtgg gcaagccgaa gaccgacgag cggcgccggc ggtccggggc cggcgcgggg      3780
     cccggggcga agccgttcgt gctggcggtg cacgccatgg cgcccggaag gctcttcgtg      3840
     aagagcgacg atcctcccat gaacgtggag ctcaaggccg acgtgaccta cgagctggcc      3900
     ggcgggaacg actacacctc gggcgagatc tccgtggtgc gcgggttcgt ggagcccatc      3960
     ggcgggcgcc acttcgagct cggccgcggg cgcgtccagt tcaccggcgg cccgccggcc      4020
     gcggccatgc tcgacgtcga ggcgacctac gagaacccgg aggcgacggt caccgtcacg      4080
     gtgacgggcc cggcgaggga gccggagatc cggctctcct cgaagccgcc gctcgacgaa      4140
     gggcagatcg cgatgctgat cgcgaccggc cggaccgagg tgaagtccgg ctccggggac      4200
     tcgagcgcgt tcacgggcga ggaggtcggc agggccgcgc tgggcgcggt ggccacccgg      4260
     gcgttcaaga acctcgtggc ggacaagctc ccgctcgaca cggtcgccgt ggactcggga      4320
     gcggtgcggg ccggaaagta cgtgacggac aagatctacg tcggctacgt gcggcgcttc      4380
     gacgcggacg tcgagcgcgg agagaacgag aacgaggcgc gcatcgagta ccggatcacg      4440
     ccgcgctgga cggccgagtc gcgctacggc acttccggct cgggcggcgc cagcctggtg      4500
     tggtcgaaga gctactga                                                    4518
//

If you have problems or comments...

PBIL Back to PBIL home page