(data stored in ACNUC7421 zone)

EMBL: CP000769.PE173

CP000769.PE173       Location/Qualifiers
FT   CDS_pept        complement(206764..207969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0175"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: ade:Adeh_0166 integral membrane protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24393"
FT                   /db_xref="GOA:A7H6P7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6P7"
FT                   /protein_id="ABS24393.1"
FT                   /translation="MDRRRSLVVTAALAGLWLAVGYVNVARGAAHAGPGYRFWSFQHHC
FT                   YSDVIALHGDRYLGGSHPLPYLEDRIEYPVLLGIALWLPSYAPGGALGHFTATYLVLAA
FT                   CLAAALLALARLPGALPWWLGATPALVYYAGLNWDVLPIALLSGALLAQERGRAGAGAA
FT                   AAALGVSAKLFPATLVPAALAALAATRPRALLRYAVVFAGVVLAVNLPFALAAPERWSW
FT                   FFRFNAGRGAENSVWQALAVPRGPLLEALSAGPLAAAAIAGAVATACAARRGGDAARAA
FT                   RLATALALVVWIATNKVWSPQYALYGFLAGALAAGPAALFAALTAVSIWDFHVAFEVRA
FT                   RRWEPWFRDHLFHPTAVVRTLLWLALAALIARALWREARGPADAATGGRAGPGGATLGA
FT                   RQ"
     gtggaccgcc gccgctcgct cgtcgtgacc gccgcgctcg ctgggctgtg gctcgccgtg        60
     ggctacgtca acgtcgcccg cggcgcggcc cacgccgggc cgggctaccg gttctggtcc       120
     ttccagcacc actgctactc cgacgtcatc gccctgcacg gcgatcgcta cctcgggggt       180
     tcgcacccgc tcccgtacct cgaggaccgc atcgagtacc cggtgctgct cgggatcgcc       240
     ctctggctcc cgtcgtacgc gccgggaggg gcgctcggtc acttcaccgc cacctacctg       300
     gtcctcgccg cgtgcctcgc cgccgcgctc ctcgccctgg cgcggctccc cggcgccctg       360
     ccctggtggc tcggggcgac gcccgcgctc gtctactacg cggggctgaa ctgggacgtg       420
     ctccccatcg ccctcctctc gggcgcgctg ctggcgcagg agcgcggccg cgccggcgcg       480
     ggggcggcgg cggcggcgct gggcgtgtcg gcgaagctct tcccggcgac gctcgtcccg       540
     gccgcgctcg ccgcgctcgc cgcgacccgg ccgcgtgcgc tcctccgcta cgcggtggtc       600
     ttcgccggcg tcgtcctcgc cgtgaacctc cccttcgcgc tggccgcccc cgagcgctgg       660
     agctggttct tccgcttcaa cgccggccgg ggcgccgaga actccgtgtg gcaggccctc       720
     gccgtcccgc gcggccccct cctcgaggcg ctctccgccg ggcccctcgc ggccgccgcg       780
     atcgccggcg ccgtcgcgac cgcctgcgcc gcccgccgcg gcggcgacgc cgcgcgcgcg       840
     gcgcggctcg ccaccgcgct ggcgctggtg gtctggatcg cgacgaacaa ggtctggagc       900
     ccgcagtacg cgctgtacgg cttcctggcg ggcgcgctcg cggccggccc cgccgcgctg       960
     ttcgcggcgc tcaccgcggt gtcgatctgg gacttccacg tggcgttcga ggtccgggcc      1020
     cggcgctggg agccgtggtt ccgcgaccac ctgttccacc ccaccgccgt cgtgcgcacc      1080
     ctgctctggc tcgcgctcgc ggcgctcatc gcccgggcgc tctggcgcga ggcgcgcggg      1140
     ccggcggacg ccgcgaccgg cgggcgcgcc ggcccgggcg gtgcgacgct cggggcccgt      1200
     cagtag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page