(data stored in ACNUC7421 zone)

EMBL: CP000769.PE176

CP000769.PE176       Location/Qualifiers
FT   CDS_pept        209710..210270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24396"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q0"
FT                   /protein_id="ABS24396.1"
FT                   /translation="MRARAPARTHLGGVDLIALYVEDHLALSLGGIRLARRSLGENRGT
FT                   PFAAPLERLIPDLEEDRDVLKDLLRALGGSRSALKEAAVVLGEYAGRLKPNGRLLSYSP
FT                   LSRVWELEGLLAGSESRRGMWNALARVQRQDRRLEGFDFAALEARARRHLDELERWRLR
FT                   AAEEAFGLAPRRRSRAATPQPAR"
     gtgcgggccc gcgcgccggc gcggacgcat cttggaggcg tggacctcat cgctctctac        60
     gtcgaagacc atctcgccct ctcgctcggc ggcatccggc tcgcgcgccg atcgctcggc       120
     gagaaccgcg gcacgccgtt cgcggcgccg ctggagcggc tcatccccga cctcgaggag       180
     gatcgcgacg tgctgaagga tctcctccgg gcgctcggcg gctcgcggag cgcgctgaag       240
     gaggcggcgg tcgtgctcgg agagtacgca ggccgcctca agcccaacgg tcgcctcctg       300
     agctactcgc cgctctcgcg ggtgtgggag ctcgaggggc tcctcgccgg cagcgagtcg       360
     cgccgcggaa tgtggaacgc gctcgcccgc gtgcagcgcc aggaccggcg cctcgagggc       420
     ttcgacttcg ccgcgctcga ggcgcgcgcg cggcgccacc tcgacgagct cgagcgctgg       480
     cggctgcgcg cggccgagga ggcgttcggg ctcgctccgc ggcgccgctc gcgcgccgcc       540
     actccccagc ccgcgcgctg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page