(data stored in ACNUC7421 zone)

EMBL: CP000769.PE18

CP000769.PE18        Location/Qualifiers
FT   CDS_pept        22419..24473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24238"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A7H692"
FT                   /protein_id="ABS24238.1"
FT                   /translation="MRRSSVLMAALALALAACGPPERSDERTSSSAPVEAAAAAKQIEL
FT                   TSYTYGKIDGQLADQLVKVFSPKKWRGETDGPVLLSGASLATLTDDQKAALKTILKEGH
FT                   AILITGVTQEQLVRAHDLIAQKYPSIKLSGTTPAELYVLAYPQERVRTLAIRSVSPGRL
FT                   PWDSEKRYAAHAKAVAEWFQEHVRGTQPVAMAVAADSNYNVLPTDSTQFPFMHSHQYEM
FT                   AAYYNGTCKTTDSCINIVKTNLYAWAVHNPLPSTSEQPTDYIVARVTGDINVSDCVLPL
FT                   GGDGDRFAGYWLQQANFSAHIPDMTVSGYRLVDGVLLGDTAPGNANPDVTVNKGVSFSF
FT                   GGSGTIGSSAGFSGAKPSAEVSKSLGFNFGVTYTNETQTTYKAMQTIAKVPADASNPSK
FT                   VLWTWDSWRFVEDNIKPANHACGGPGLLKENLPSIIYGGGLSGADASQAEFVWALKPDV
FT                   RRALGTNVNDGYTYLPVQVDTSMLLGWAFFWQDIGYCSESDASATGYHYKLGGKSIDIV
FT                   GTTSSPFATAPNNTALYAGDGLAFDSGCGTAVNFGTIPLGNRLSCDGNHPCLNPGPPFA
FT                   FEPMEVTIPLAPDPRRMTLTSIEPTAGPMGARITLRGTALNTATYVYIGGQPAPASLEF
FT                   ENGVPVITTVAPALNYPAGYTVRIEVQNAVVTSQDFDFTYTGMPPAPDD"
     atgcgtcgct cgagcgtact catggcagcg ctggcgctgg cgctggcggc ctgcggcccg        60
     cccgaacgga gcgatgagcg gaccagctca tccgcgccgg tcgaggcggc ggcagcggcg       120
     aagcagatcg agctcaccag ctacacgtat ggaaagatcg acgggcagct ggccgatcag       180
     ctcgtgaagg tgttctcccc caagaagtgg cgcggagaga ccgacggccc ggtgctcctc       240
     tccggagcga gcctcgccac gctcaccgac gatcagaagg ccgcgctgaa gacgatcctg       300
     aaggaggggc atgccatcct gatcacgggc gtcacgcagg agcagctcgt gcgggcgcat       360
     gacctcatcg cccagaagta tccctcgatc aagctctcgg gcaccacgcc agcggagctc       420
     tacgtgctcg cctaccccca ggagcgagtg cgcacgctgg cgatccgatc cgtctccccc       480
     gggcgccttc cctgggacag cgagaagcgc tacgcggctc acgcgaaggc ggtcgccgaa       540
     tggttccagg agcacgtccg ggggacgcag ccggtcgcca tggccgtcgc cgcggacagc       600
     aactacaacg tcttgccgac cgacagcacg cagtttccgt tcatgcactc tcaccagtac       660
     gagatggcgg cgtactacaa cgggacgtgc aagacgacgg attcgtgcat caacatcgtc       720
     aagacgaatc tgtatgcctg ggcggtgcac aaccccttgc cgtcgacgtc ggagcagccc       780
     accgattaca tcgtcgcgcg ggtgacgggc gacatcaacg tctcggactg cgtgctcccc       840
     ctcggtggcg atggggatcg gttcgcgggc tactggctcc agcaagccaa cttcagcgcc       900
     cacatcccgg acatgacggt gagtggctac cggctggtgg acggcgtcct gctgggcgac       960
     accgcgcctg ggaacgcgaa ccccgacgtg acggtgaaca agggcgtcag cttcagcttc      1020
     ggggggtcgg ggacgatcgg ctcgagcgcg gggttctcgg gggcgaagcc cagcgcagag      1080
     gtcagcaagt ccctcggctt caacttcggc gtgacctaca cgaacgagac gcagaccacc      1140
     tacaaggcga tgcagacgat cgcgaaggtc cccgccgacg catcgaatcc atcgaaggtg      1200
     ctgtggacct gggattcctg gcgcttcgtc gaggacaaca tcaagccggc caaccacgcc      1260
     tgtggcggcc ccgggctcct caaggagaat ctcccgtcca tcatctacgg gggtgggctc      1320
     agcggggcag acgcgtccca ggcggaattc gtgtgggcgc tgaagcccga cgtccgtcgc      1380
     gcgctgggga ccaacgtcaa tgacggttac acctacctgc ccgtgcaggt cgacacgtcc      1440
     atgctcctgg gatgggcgtt cttctggcag gacatcggct attgctccga gagcgacgcc      1500
     tcggccacgg ggtaccatta caagctcggc gggaagagca tcgacatcgt gggcacgacg      1560
     agctccccgt tcgccaccgc cccgaacaac acggccctgt atgccgggga tggcctcgcg      1620
     ttcgattcgg gctgcggcac cgcggtgaac ttcggcacca tcccgctcgg gaacaggctg      1680
     agctgcgatg gcaatcaccc ctgcctcaac cccggtcctc cctttgcgtt cgagcccatg      1740
     gaggtcacga tcccgctcgc cccggatccg cgcaggatga cgctgacgag catcgagccg      1800
     acggccggtc cgatgggcgc gaggatcacg ctgcgaggaa ccgccctgaa caccgccacg      1860
     tacgtgtaca tcggtggaca gccggccccg gcgtcactgg agttcgagaa cggcgtcccg      1920
     gtgatcacga cggtggcccc ggccctgaac tatccggccg ggtatacggt ccggatcgag      1980
     gtccagaacg ccgtcgtgac cagccaggac ttcgacttca cgtatacggg tatgccgccg      2040
     gcgccagacg actag                                                       2055
//

If you have problems or comments...

PBIL Back to PBIL home page