(data stored in ACNUC7421 zone)

EMBL: CP000769.PE180

CP000769.PE180       Location/Qualifiers
FT   CDS_pept        complement(213450..214454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0182"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sus:Acid_4473 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24400"
FT                   /db_xref="GOA:A7H6Q4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Q4"
FT                   /protein_id="ABS24400.1"
FT                   /translation="MDQLGVATVLRLFLRGSRNYLADRPLVVSFELTGSCNARCKHCDK
FT                   GGILRDETPLSPQRIGEIYRELRPVAVQLSGGEPLLRRDVVEVARAIKERRGAPYLIVV
FT                   SNGTLLSAPKYEALRAAGVNQFSISLDFPDERHDDFRSVPGLFRRLERLVPELTSRGHG
FT                   DVVLNCAVSRLNAGDLTRLCETARRWGSSISFSAYSALRTGNTDYLVSSPEDLRGLRAQ
FT                   LDAVLDLKRRGGPVRNPAPDLDGLYRFFADGGIPGCRAGYRFLLVTPEGFFRPCAHKPV
FT                   KARSQRELIQRFARTNDCRGCYVAIRSYCDKSYLPLLREQVLTRLGLSAAAPR"
     atggaccagc tcggcgtcgc gaccgtcctc cgcctcttcc tgcgcggcag ccggaactac        60
     ctggcggatc gcccgctggt cgtctccttc gagctcaccg gctcctgcaa cgcccggtgc       120
     aagcactgcg acaagggcgg gatcctgcgc gacgagacgc cgctctcgcc gcagcgcatc       180
     ggcgagatct accgtgagct ccggccggtg gcggtccagc tctccggcgg cgagcccctg       240
     ctccgccgcg acgtggtgga ggtggcgcgc gcgatcaagg agcgccgcgg cgccccctac       300
     ctcatcgtgg tcagcaacgg cacgctcctg agcgccccca agtacgaggc gctgcgcgcc       360
     gccggcgtga accagttctc catctcgctc gacttccccg acgagcgcca cgacgacttc       420
     cgcagcgtac ccggcctctt ccgcaggctc gagcggctcg tgccggagct gacctcgcgc       480
     ggccacggcg acgtggtgct gaactgcgcc gtgtctcgcc tcaacgccgg cgacctgacc       540
     cggctgtgcg agacggcgcg cagatggggc tcgagcatct ctttcagcgc gtactccgcc       600
     ctgcggacgg ggaacacgga ctacctcgtc tcgtcgcccg aggacctgcg agggctgcgg       660
     gcccagctcg acgcggtcct cgacctcaag cggcggggag ggcccgtgcg caacccggcg       720
     cccgacctgg acggcctcta ccgcttcttc gcggacgggg ggatccccgg ctgccgcgcc       780
     ggctatcgct tcctgctcgt cacgcccgag gggttcttcc gcccgtgtgc ccacaagccg       840
     gtgaaggcgc gctcgcagcg ggagctgatc cagcgcttcg cgcgcacgaa cgactgccgc       900
     ggctgctacg tcgccatccg cagctactgc gacaagagct acctgccgct cctgcgcgag       960
     caggtgctca cccggctcgg cctgtccgcg gccgcgccgc gctga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page