(data stored in ACNUC7421 zone)

EMBL: CP000769.PE186

CP000769.PE186       Location/Qualifiers
FT   CDS_pept        complement(219519..220388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24406"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R0"
FT                   /protein_id="ABS24406.1"
FT                   /translation="MSATHPPCDAVAMRSGPWLGAALAALIAGCAARQAPGDPLSGRPI
FT                   RTASPEELARRLVDDAAGLVALKGKVTLTFQERAAAGARSCRGALAARSPWSDGAAPGL
FT                   FVEGYRSLMPTLFTLVSDGERFWLHVPSERVVYTGTTVRGVVARGRELRLDARALLRAL
FT                   FVEPPGPADALEVREDGETYVLSIRRAGRLHRRLWVERRRFAVEREVLYDADGREELVI
FT                   LRERQRERDGRLQPERLSVQDPVAGGSVLVEFDSLTVNPPGLDARAFRPLSPPGARVER
FT                   VDGTERDR"
     gtgtccgcca cccatccgcc gtgcgacgct gtggccatgc gatccgggcc gtggctgggg        60
     gcggcgctcg cggcgctgat cgcgggctgc gcggcgcgcc aggcgccagg cgatccgctc       120
     tccggacgcc cgatccgcac ggcctcgccc gaggagctcg cgcggcggct cgtcgacgac       180
     gccgcgggcc tcgtggcctt gaagggaaag gtcaccctca ccttccagga gcgcgcggcc       240
     gcgggcgcgc gctcctgccg cggcgcgctc gcggcccgca gcccgtggag cgacggcgcg       300
     gcgcccgggc tgttcgtgga gggctaccgc tccctcatgc cgacgctgtt cacgctggtg       360
     agcgacggtg agcgcttctg gctgcacgtc ccgagcgagc gcgtggtgta cacgggcacc       420
     acggtgcgcg gcgtcgtggc ccggggccgg gagctccgcc tggacgcgcg cgcgctcctc       480
     cgcgcgctgt tcgtggagcc gcccggcccc gcagacgcgc tggaggtccg ggaggacggc       540
     gagacgtacg tcctctcgat ccgccgggcg ggccggctgc accggcggct ctgggtggag       600
     cggcggcggt tcgccgtcga gcgcgaggtg ctctacgacg ccgacgggcg ggaggagctc       660
     gtcatcctcc gggagcgcca gcgtgagcgc gacgggcggc tccagcccga gcggctgagc       720
     gtgcaggacc ccgtcgccgg cggctccgtc ctcgtcgagt tcgattctct cacggtgaat       780
     ccgcccgggc tggacgcgcg cgccttccgg ccgctgtctc cccccggagc gcgggtcgag       840
     agggtcgacg ggacggagcg cgaccggtga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page