(data stored in ACNUC7421 zone)

EMBL: CP000769.PE187

CP000769.PE187       Location/Qualifiers
FT   CDS_pept        complement(220443..224687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0189"
FT                   /product="putative CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: putative CoA-substrate-specific enzyme
FT                   activase; PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   ade:Adeh_3814 CoA enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24407"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R1"
FT                   /protein_id="ABS24407.1"
FT                   /translation="MPRFLGVDAGAETLKVVELAGEPGGLVWRRRARVEHHKTPGAALG
FT                   ELLREWGWDGLRGAVATGRLGRQLALSRVPGKQARLAGHRFLRGDGPAVIVDIGAHGFS
FT                   VLEVNGGEDAEYRENPRCSQGTGNFLRQLVERFGLAPEEADVLAAPVEEPAHLSGRCPV
FT                   ILKTDMTHLANQGEDRARILAGLFDAICDNVQVLLRSRAGAVSPAVVLAGGVGRSRRVR
FT                   ERFRRRLAERGMTLAEEHGEDALYLDALGCAVLAARGDGPLPRPEDLVSPPAHAPVELR
FT                   PPLSDAMGSVHRLPRRAPPPVSEGDAFLLGLDIGSTGSKVVALHVPSGAPLWESYTRTA
FT                   GDPVGAAQELVRRAAGGPAGAAVAGFGVTGSGREIVGSLLTTCFGGDRVHVLNEIAAHA
FT                   EGARACDPRVDTIFEIGGQDAKYIRLAAGRVVDAAMNEACSAGTGSFIEEQGVRLGNLD
FT                   VEALARVAVGADACAALGQHCAVFMAEILDEAAAAGVTRPRLVAGLYDSVVQNYLNRVK
FT                   GNRSVGEVVFCQGMPFAADALAAAVARQTGAEVIVPPNPGTVGAWGIALLAREALASGA
FT                   PLELARFLDARVERKDTFVCRSSTGCGGSGNACRIERIRTRVQGERRAFSWGGGCSLHD
FT                   GGTRARKLPDGAPDPFRERAELVEAVLRPLAAPTGAPRVALAEAFQLKGLFPFFARFFR
FT                   ALDFDLVVAQGGGREALRRGAEGANVPFCAPMQQYHGLVAALAQAPAERVFLPMLRDLP
FT                   PVKDEESHWLCPIVAGSADVLRLDLRPLLAGRRVLSPAIKLGPGFLDAPAFLDTCRSIA
FT                   EDLGVRDEETWRAAHAAAREEQARFDAALIGIGRSALERCRAGGLLPVVVLGRTYTIHD
FT                   PVLSANIPALLREQGAVAIPTDCYPTDPATPMVPGAFWGYTQRILRAAHEVRRTPGVYS
FT                   LFASNYGCGPDSFTLHAYARLMEGKPFAVIETDGHAGDAGTKTRVEAFLHCVREDLRSG
FT                   GSAAASAAPLLALASQSLPEIARRGSRVLVPPMGAEAHSLAAALRGYGVPAEVLPAASA
FT                   EAIRQARRHTSGKECLPMIVTLGSLLQRLERADPGERLSFFMPGSNGPCRFGYYRQLHQ
FT                   MILERLGHGARVGIWSPPDSDYFAGVPAGFGALVFAGIAAFGLLEDALRDVRPVERERG
FT                   AAARVHAAASGELTRLLERAAGADLSARRVLLEAASGGNYGVTALLERTGRALRALKTA
FT                   RPHPTVMLVGEIYLRSDPGANGGVGDALEERGVRVRLEPVAEYLEYSDHVQVRRGLRGA
FT                   PQDRLKGWIRRRILRTCRRAMARAMGWPDHPRLDEALAAAAPYLRDDLEHEAVLAVGLP
FT                   LVQWRRGEIDGAVCVGPLECMPDKLTEAQLVHAREREGLLSLTLSLNGDPIDPEILDAF
FT                   AYEVKERFRRRA"
     atgccgcgtt tcctcggggt ggacgcaggt gccgagacgt tgaaggtggt cgagctcgcc        60
     ggcgagccgg gaggcctcgt ctggcgccgg cgcgcccggg tcgagcacca caagacgccc       120
     ggggccgccc tcggcgagct cctccgcgag tggggctggg acggcctccg cggcgcggtc       180
     gccaccggcc gcctcggccg gcagctcgcg ctctcgcggg tcccgggcaa gcaggcgcgc       240
     ctcgcgggcc accgcttcct ccgcggcgac gggcccgccg tcatcgtcga catcggcgcg       300
     cacggcttct cggtcctgga ggtgaacggc ggcgaggacg ccgagtaccg ggagaacccg       360
     cgctgctcgc aaggcaccgg caacttcctg cggcagctcg tggagcgctt cggcctcgcg       420
     cccgaggagg ccgacgtcct cgcggcgccc gtggaggagc cggcgcacct ctccgggcgc       480
     tgccccgtca tcctcaagac ggacatgacc cacctcgcga accagggcga ggaccgggcg       540
     cggatcctcg cgggcctctt cgacgccatc tgcgacaacg tgcaggtgct gctccgctcc       600
     cgggcgggcg ccgtctctcc cgcggtggtg ctcgccggag gcgtcggacg ctcgcgcagg       660
     gtccgcgagc ggttccgccg ccgcctggcg gagcgcggga tgacgctcgc cgaggagcac       720
     ggcgaggacg cgctgtacct ggacgcgctc ggctgcgccg tgctggcggc gcggggcgac       780
     gggccgctgc cgaggccgga ggacctcgtc tcgccgccgg cccacgcgcc ggtggagctg       840
     cgtccccccc tgtccgacgc catgggcagc gtccaccgcc tcccgcgccg tgcaccaccc       900
     ccggtgagcg aaggcgacgc gttcctactc gggctcgaca tcggctcgac cggctccaag       960
     gtggtggcgc tccacgtccc ctcgggcgcg ccgctctggg agagctacac ccgcacggcc      1020
     ggggacccgg tgggcgcggc gcaggagctg gtgcgccggg ccgccggagg gccggccggc      1080
     gcggccgtgg cgggcttcgg cgtcaccggc agcggccgcg agatcgtcgg atcgctcctc      1140
     acgacctgct tcggcggcga ccgcgtgcac gtcctgaacg agatcgccgc ccacgccgag      1200
     ggggcgcgcg cctgcgaccc gcgggtcgac accatcttcg agatcggcgg ccaggacgcg      1260
     aagtacatcc ggctcgcggc ggggcgggtg gtggacgccg cgatgaacga ggcgtgcagc      1320
     gccggcacgg gctcgttcat cgaggagcag ggcgtccgcc tcgggaacct cgacgtggag      1380
     gcgctggcgc gcgtcgcggt cggggccgac gcctgcgccg ccctcggcca gcactgcgcg      1440
     gtgttcatgg cggagatcct cgacgaggcg gcggccgccg gcgtcacgcg gccgcgtctc      1500
     gtcgccgggc tctacgactc ggtggtgcag aactacctga accgcgtgaa gggcaaccgc      1560
     tcggtgggcg aggtggtctt ctgccagggg atgccgttcg ccgcggacgc gctcgcggcg      1620
     gcggtcgcgc ggcagaccgg cgccgaggtg atcgtgcccc cgaatcccgg cacggtgggg      1680
     gcgtggggga tcgcgctgct cgcgcgcgag gcgctcgcct cgggcgcgcc gctcgagctg      1740
     gcgaggttcc tcgacgcgcg ggtggagcgg aaggacacct tcgtctgccg ctcgagcacc      1800
     ggctgcggcg gctcggggaa cgcctgccgc atcgagcgga tccgcacccg ggtgcagggg      1860
     gagcggcgcg ccttctcctg ggggggtggg tgctcgctcc acgacggagg gacgcgcgcg      1920
     cgcaagctcc ccgacggcgc gcccgatccg ttccgcgagc gagccgagct ggtggaggcg      1980
     gtgctgcgac cgctggcggc gccgacgggc gcgccgcggg tcgcgctcgc ggaggcgttc      2040
     cagctgaagg ggctgttccc gttcttcgcc cggttcttcc gcgcgctcga cttcgacctc      2100
     gtggtggcgc agggcggggg gcgggaggcg ctgcgccgcg gggcggaggg ggcgaacgtc      2160
     ccgttctgcg cgccgatgca gcagtaccac ggcctcgtgg cggccctggc gcaggcgccc      2220
     gccgagcgcg tgttcctgcc catgctccgc gacctgcccc ccgtgaagga cgaggagtcg      2280
     cactggctct gcccgatcgt ggcggggagc gccgacgtgc tccggctcga cctgcgcccg      2340
     ctcctcgccg gacggcgggt gctctcgccg gcgatcaagc tcggcccggg cttcctcgac      2400
     gcgccggcgt tcctcgacac ctgccgctcc atcgccgagg acctgggcgt ccgcgacgag      2460
     gagacctggc gcgccgccca cgccgccgcg cgcgaggagc aggcgcgctt cgacgccgcg      2520
     ctgatcggga tcgggcgcag cgccctcgaa cgctgccgcg ccggggggct cctccccgtg      2580
     gtcgtgctcg gccgcaccta cacgatccac gacccggtcc tgagcgccaa catcccggcg      2640
     ctgctgcgcg agcagggggc ggtcgcgatc cccaccgact gctaccccac ggatcccgcc      2700
     acccccatgg tgccgggcgc gttctggggc tacacgcagc ggatcctccg ggccgcccac      2760
     gaggtgcggc gcacgcccgg cgtctacagc ctgttcgcga gcaactacgg gtgcgggccc      2820
     gacagcttca ccctccacgc gtacgcgcgc ctcatggagg ggaagccctt cgcggtcatc      2880
     gagacggacg gccacgccgg cgacgcgggg acgaagacgc gcgtggaggc cttcctccac      2940
     tgcgtccgcg aggatctgcg ctccggtggg agcgccgcgg cctcggccgc gccgctgctc      3000
     gcgctcgcct cccagtcgct gcccgagatc gcgcgtcgag gctcgcgcgt gctcgtgccg      3060
     cccatgggcg ccgaggccca ctcgctcgcg gcggcgctgc gcgggtacgg cgtccccgcg      3120
     gaggtgctcc cggcggcgag cgcggaggcg atccgccagg cgcggcgcca cacgagcggc      3180
     aaggagtgcc tgccgatgat cgtgacgctc ggctcgctgc tccagcggct cgagcgcgcc      3240
     gacccgggcg agcggctctc gttcttcatg ccggggtcga acggcccctg ccggttcggc      3300
     tactaccggc agctccacca gatgatcctc gagcggctcg ggcacggcgc gcgcgtgggg      3360
     atctggtcgc cgcccgactc ggactacttc gcgggtgtgc cggccgggtt cggcgcgctc      3420
     gtcttcgcgg ggatcgccgc gttcggcctg ctggaggacg cgctccgcga cgtccgtccg      3480
     gtggagcgcg agcgaggggc cgcggcgcgc gtccacgcgg cggcctccgg cgagctcacg      3540
     cggctcctgg agcgcgcggc cggcgccgac ctctcggcgc gccgcgtgct gctggaggcc      3600
     gcgagcggcg ggaactacgg cgtcacggcg ctgctcgagc gcaccggccg cgcgctgcgg      3660
     gcgctcaaga ccgcgcggcc gcaccccacc gtgatgctcg tgggcgagat ctacctgcgc      3720
     tccgatccgg gggcgaacgg cggcgtgggc gacgccctcg aggagcgcgg ggtccgggtg      3780
     cggctcgagc cggtggccga gtacctggag tactccgatc acgtccaggt gcgccgcggc      3840
     ctccgcggcg cgccgcagga ccgcctcaag ggctggatcc gccggcgcat cctccgcacg      3900
     tgccggcgcg cgatggcgcg ggccatgggg tggccggatc acccgcgcct ggacgaggcg      3960
     ctcgcggccg cggcgcccta cctccgcgac gatctcgagc acgaggcggt gctcgcggtg      4020
     ggcctccccc tcgtgcagtg gcggcgcgga gagatcgacg gcgcggtctg cgtgggcccg      4080
     ctcgagtgca tgcccgacaa gctgaccgag gcccagctcg tccacgcgcg ggagcgcgag      4140
     ggactcctct ccctgaccct ctcgctcaac ggcgacccga tcgacccgga gatcctcgac      4200
     gccttcgcct acgaggtgaa ggagcgcttc cggcgccgcg cttga                      4245
//

If you have problems or comments...

PBIL Back to PBIL home page