(data stored in ACNUC7421 zone)

EMBL: CP000769.PE189

CP000769.PE189       Location/Qualifiers
FT   CDS_pept        225766..226755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0191"
FT                   /product="TGS domain protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; TGS domain
FT                   protein; KEGG: ade:Adeh_2114 GTP-binding protein,
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24409"
FT                   /db_xref="GOA:A7H6R3"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R3"
FT                   /protein_id="ABS24409.1"
FT                   /translation="MPANLTTQYKDAELRFRQATDHDAKREALREMLALLPKHKGTEKL
FT                   HADLKKRLAKLEEEAGHAARGGHRADPGHVRREGAGQWILVGPPNAGKSSLLAALTHAH
FT                   PEIGEYPFTTRAPLPGMAAVEDVQVQLVDTPPVAAGHTEPYLPNLVQGADGVIVVLDPT
FT                   ADDVAQAFAAVLEVLSRGHVWPRGRAPPQGASPLLVARPVLVVATRRDLDDGGTFAALA
FT                   RDAAGAELPFFAVSATRGDGLDALRPELFRALGRIRVYTKEPGKKPDLGKPFVLPAGAT
FT                   VHDLAALVHHDVAAHLKFARIWGHARFEGQQVDRHHVLADRDVVELHA"
     gtgcccgcga acctcaccac ccagtacaag gacgcggagc tgcgcttccg ccaggcgacg        60
     gatcacgacg cgaagcgcga ggcgctccgc gagatgctgg cgctcctccc caagcacaag       120
     gggacggaga agctccacgc ggacctcaag aagcggctgg cgaagctcga ggaggaggcc       180
     gggcacgcgg cgcgcggcgg ccaccgcgcc gaccccgggc acgtgcggcg cgagggcgcc       240
     gggcagtgga tcctggtcgg cccgccgaac gcggggaagt cctcgctcct cgcggcgctc       300
     acccacgcgc accccgagat cggcgagtac ccgttcacca cgcgcgcgcc gctgcccggg       360
     atggcggcgg tcgaggacgt gcaggtgcag ctcgtggaca cgccccccgt cgcggcgggg       420
     cacaccgagc cgtacctgcc caacctcgtg cagggcgcgg acggcgtgat cgtggtgctc       480
     gacccgaccg ccgacgacgt ggcgcaggcg ttcgcggcgg tcctcgaggt gctctcgcga       540
     ggtcacgtgt ggccgcgcgg gcgcgcgccg ccccagggcg cgtcgcccct cctcgtcgcg       600
     cggccggtgc tggtggtcgc cacccgccgc gatctcgacg acggcggcac gttcgccgcg       660
     ctcgcgcgcg acgcggcggg cgcggagctg cccttcttcg cggtgtcggc gacgcgcggc       720
     gacgggctcg acgcgctccg gcccgagctg ttccgcgcgc tgggacggat ccgcgtctac       780
     acgaaggagc ccggcaagaa gcccgatctg ggcaagccct tcgtgctccc cgccggcgcg       840
     accgtgcacg acctcgccgc gctcgtgcac cacgacgtcg ccgcgcacct caagttcgcg       900
     cgcatctggg gccacgcgcg cttcgagggc cagcaggtcg accgccacca cgtcctcgcg       960
     gatcgcgacg tggtggagct gcacgcgtga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page