(data stored in ACNUC7421 zone)

EMBL: CP000769.PE192

CP000769.PE192       Location/Qualifiers
FT   CDS_pept        complement(229572..230408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24412"
FT                   /db_xref="GOA:A7H6R6"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R6"
FT                   /protein_id="ABS24412.1"
FT                   /translation="MTSNPRFLALLAVLALAAAPASAQQAGGARATAAAAEPPFQAFSS
FT                   TNVQLLQGYNFDDPLYYTDGRMTTVTLNHFSTWEYGDNFAFADFYAGHFRNGFSPSHED
FT                   AGEYKLYAEWHPRLFLNRVLGQKEPLFGFIKNWGLAGELNQSEGFGAYLAGVGFDLTLP
FT                   GFAVAGLNLYYRYDSVLDSIDEGNQWQVSPFWTVPFSIGKVPFLFTGFVDVNGTHDFAA
FT                   DESFVEIWAQPQLLVDALAPFGGKPNRLWVGTEWFYHRHPVETASAPQIMVQWTVY"
     atgacctcga acccccgctt cctcgccctc ctcgccgtgc tcgcgctcgc cgcggcgccg        60
     gcgagcgccc agcaggcggg cggcgcgcgc gcgaccgccg ccgccgccga gccgcccttc       120
     caggccttct cgagcaccaa cgtccagctg ctccagggct acaacttcga cgatccgctc       180
     tactacaccg acggtcgcat gaccacggtg acgctgaacc acttctcgac ctgggagtac       240
     ggcgacaact tcgcgttcgc cgacttctac gccggccact tcaggaacgg gttcagcccc       300
     tcccacgagg acgccggcga gtacaagctg tacgccgagt ggcaccctcg cctgttcctg       360
     aaccgcgtgc tcggccagaa ggagccgctg ttcggcttca tcaagaactg gggcctcgcg       420
     ggcgagctga accagagcga gggcttcggc gcctacctcg ccggcgtcgg cttcgacctc       480
     accctcccgg gcttcgcggt ggccggcctg aacctctact accgctacga ctccgtcctc       540
     gactcgatcg acgaggggaa ccagtggcag gtgagcccgt tctggacggt gcccttctcg       600
     atcggcaagg tgcccttcct cttcacgggc ttcgtcgacg tgaacggcac gcacgacttc       660
     gccgcggacg agtccttcgt cgagatctgg gcgcagcccc agctcctcgt ggacgcgctc       720
     gcgccgttcg gcgggaagcc gaaccggctg tgggtcggga ccgagtggtt ctaccaccgc       780
     cacccggtgg agaccgcctc ggcgccgcag atcatggtgc agtggacggt gtactag          837
//

If you have problems or comments...

PBIL Back to PBIL home page