(data stored in ACNUC7421 zone)

EMBL: CP000769.PE193

CP000769.PE193       Location/Qualifiers
FT   CDS_pept        complement(230507..231532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0195"
FT                   /product="Arginine N-succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="PFAM: arginine N-succinyltransferase beta subunit;
FT                   KEGG: ade:Adeh_0178 arginine N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24413"
FT                   /db_xref="GOA:A7H6R7"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6R7"
FT                   /protein_id="ABS24413.1"
FT                   /translation="MLLLRDAQKSDLPSLSRLAKVLNTVNLPYDERALARIIEQSVRSF
FT                   AGRIRDPLQRAYVFVAEEPRSGRIIGTSMVIAQHGTRESPCTFFDVSEREHYSSTIDRH
FT                   FKHEVLSIGYHFDGPTEIGGLVVDPEERGGEERAGKQLAYVRFLYLAMFRERFREKVLA
FT                   ELMPPLTKDGRSAFWEAFGKRFTDLDYQTADKKSRENKEFIQQLFPPVDVYATLFPEQV
FT                   QRNLGKVGPETEPVRRMLERIGFHYVNRIDPFDGGPHYEARLEDVTLVRAYRRAKLAPE
FT                   PLERDGEERLVGRYRTGGKIRFRAVRTPARLDGEVLRIPAKARAILEASPGERLHLVPF
FT                   E"
     atgctcctcc tccgcgacgc gcagaagtcg gatctcccga gcctctcccg gctcgcgaag        60
     gtgctgaaca ccgtcaacct cccgtacgac gagcgcgcgc tcgcccggat catcgagcaa       120
     tcggtgcgca gcttcgcggg gcgcatccgc gatccgctgc agcgcgccta cgtgttcgtc       180
     gccgaggagc cgcgctccgg ccgcatcatc ggcacctcga tggtgatcgc gcagcacggc       240
     acgcgggagt ccccctgcac cttcttcgac gtctccgagc gcgagcacta ctcgtccacg       300
     atcgaccggc acttcaagca cgaggtcctc tcgatcggct accacttcga cggcccgacg       360
     gagatcggcg gcctggtcgt ggacccggag gagcggggcg gcgaggagcg cgcgggcaag       420
     cagctcgcct acgtccgctt cctgtacctg gcgatgttcc gcgagcggtt ccgcgagaag       480
     gtcctcgccg agctcatgcc gccgctcacc aaggacgggc ggagcgcgtt ctgggaggcg       540
     ttcggcaagc gcttcaccga cctcgactac cagaccgccg acaagaagag ccgcgagaac       600
     aaggagttca tccagcagct cttcccgccc gtggacgtgt acgcgacgct cttcccggag       660
     caggtgcagc gcaacctcgg caaggtcggc ccggagaccg agccggtgcg gcggatgctc       720
     gagcggatcg ggttccacta cgtgaaccgc atcgatccgt tcgacggcgg tccgcactac       780
     gaggcgaggc tcgaggacgt gacgctggtg cgcgcgtacc ggcgggcgaa gctggccccg       840
     gagccgctgg agcgcgacgg cgaggagcgg ctcgtcgggc gctaccggac gggcggcaag       900
     atccgcttcc gggcggtgcg caccccggcc cggctcgacg gcgaggtgct ccgcatcccc       960
     gcgaaggcac gcgcgattct cgaggcgagc cccggcgagc ggctccacct cgtgcccttc      1020
     gagtag                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page