(data stored in ACNUC7421 zone)

EMBL: CP000769.PE198

CP000769.PE198       Location/Qualifiers
FT   CDS_pept        234534..234788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24418"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6S2"
FT                   /protein_id="ABS24418.1"
FT                   /translation="MRSFDSPRRRRYRLLKMRSSRNLEEGDASAPHACEDVRCGCGCLL
FT                   ARVIDGAVELKCRRCKHVWRLPVEGAPRPLARPDRVDAG"
     atgcgctcgt ttgacagccc ccggcggcgc cgctatcgtc tgctgaaaat gagaagcagt        60
     cgcaacttgg aggagggaga cgcctcggcg ccgcacgcgt gcgaggacgt ccgctgcggg       120
     tgcggctgcc tgctcgcccg ggtgatcgac ggcgcggtgg agctgaagtg ccgccgctgc       180
     aagcacgtct ggcggctccc cgtcgagggt gctccccgtc ccctcgcgcg cccggatcgc       240
     gtcgacgctg ggtga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page