(data stored in ACNUC7421 zone)

EMBL: CP000769.PE209

CP000769.PE209       Location/Qualifiers
FT   CDS_pept        243522..244613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24429"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T3"
FT                   /protein_id="ABS24429.1"
FT                   /translation="MVLMRSPSSVGSGPAPSFDLAAFRRALTDRTAAAVKALRAQIGSE
FT                   TLYAFALYTSAESGYAWVEASANTEEGLARAATSRAADDPRFRGEAGRRLLRWSVEDWA
FT                   HHDFDAAVRAVPLPDPLERRESLDRALLTAMVGALRTLDRAGLFGRGADRAFLTVNVLC
FT                   PHPSRAFFVRNLRALNPVPTVERHLRETDPAPFVRAVNRAPRRERMRIWLALYEDLYME
FT                   WKTPIAEEARARGMSPWEVEVELARFGPKVVPKLVDLLAHYGFAPPFDSARELETREVW
FT                   LAGSALFLVRRIGLVPESQIRRLQALVGAFEERDRRLKIASTLAENTARVLHELRPRKF
FT                   PESVMDPQTYKLLNPEPFLPRRP"
     ttggtgctca tgcgatcgcc gtcctccgtc ggctccgggc ccgcgccgtc gttcgatctc        60
     gccgccttcc ggcgcgcgct caccgatcgc acggccgccg cggtgaaggc gctgcgagcc       120
     cagatcggct cggagaccct ctacgccttc gcgctctaca cgagcgccga gtccggctac       180
     gcgtgggtcg aggcctccgc gaacacggag gaggggctgg cgcgcgccgc gacttcccgg       240
     gcggcggacg atccgcgctt ccgcggcgag gcggggcggc gcctgctccg ctggtcggtg       300
     gaggactggg cgcaccacga cttcgacgcg gccgtgcggg cggtgccgct cccggatccc       360
     ctggagcggc gcgagtccct ggaccgcgcc ctgctgacgg cgatggtggg cgcgctgcgg       420
     acgctcgacc gggcggggct gttcgggcgg ggggcggatc gcgccttcct cacggtgaac       480
     gtgctgtgcc cgcacccgtc gcgcgcgttc ttcgtgcgga acctgcgcgc cctgaacccc       540
     gtccccacgg tggagcgcca cctccgcgag acggaccccg cccccttcgt gcgcgcggtg       600
     aaccgcgccc cgcgccgcga gcggatgcgg atctggctcg ccctgtacga ggacctgtac       660
     atggagtgga agacgcccat cgccgaggag gcgcgggcgc gcggcatgtc cccgtgggag       720
     gtggaggtcg agctcgcccg gttcggcccc aaggtcgtgc cgaagctcgt cgatctgctc       780
     gcccactacg gcttcgcgcc gccgttcgac tccgcccgcg agctcgagac gcgcgaggtc       840
     tggctggccg gcagcgcgct cttcctcgtc cggcgcatcg gcctggtgcc cgagtcccag       900
     atccgcaggc tgcaggcgct ggtgggcgcg ttcgaggagc gcgaccgccg cctcaagatc       960
     gcctccacgc tcgccgagaa caccgcccgc gtgctgcacg agctccgccc gcggaagttc      1020
     ccggagagcg tgatggaccc gcagacctac aagctgctca accccgagcc cttcctgccc      1080
     cgccgcccgt ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page