(data stored in ACNUC7421 zone)

EMBL: CP000769.PE211

CP000769.PE211       Location/Qualifiers
FT   CDS_pept        complement(245543..245839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0213"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   KEGG: ade:Adeh_0196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24431"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6T5"
FT                   /protein_id="ABS24431.1"
FT                   /translation="MPIYEYECPKCGRFDHLQKMSSPALEVHDVCGSKVTKLMSASAFA
FT                   FKGSGFYITDYNGRNSAAITGKGDKAESKPEPKVESKPDACATCPAKQGAGAC"
     atgcccatct acgagtacga gtgccccaag tgcgggcggt tcgaccacct gcagaagatg        60
     tcttcgccgg cgctcgaggt ccacgacgtc tgcggctcca aggtgacgaa gctcatgtcc       120
     gcgagcgcgt tcgccttcaa gggctcgggc ttctacatca ccgactacaa cggccggaac       180
     tccgccgcga tcaccggcaa gggcgacaag gccgagtcga agccggagcc gaaggtcgag       240
     tccaagcccg acgcgtgcgc gacctgcccg gccaagcagg gcgcaggcgc gtgctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page