(data stored in ACNUC7421 zone)

EMBL: CP000769.PE216

CP000769.PE216       Location/Qualifiers
FT   CDS_pept        complement(249473..251272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0218"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   ade:Adeh_0203 GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24436"
FT                   /db_xref="GOA:A7H6U0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U0"
FT                   /protein_id="ABS24436.1"
FT                   /translation="MQDVLGNTLGLKPSQLHALRRTYRRRVDAASIVSPELARHLSEVS
FT                   RETNRQIGVLLDRKGDVHSVIVGDARKLELPDVGRGRAGESRLRGLRLVHTHLNGEPLT
FT                   RDDHTDLALLRLDLVAAIEVREDGLPGKVHFAHLVPENAQGAMWKDEAAASVHDLAYDA
FT                   LSGALALEEEFARARAVRRTGGRERAILVGFGGKGRSRADAESSLEELKELARTAGVEV
FT                   IDATVQLRRDPDPRYLIGKGKLEDVVLRSMQLMATVIVFDAELSPSQARHIAEATSLKI
FT                   LDRTQLILDIFAQRAQSADGKLQVELAQLKYLYPRLVGRDDSLSRLAGGIGGRGPGETK
FT                   LEIDRRRVRDRITALERRIEALGSSRQLRRKQRNGRGLPVLSIVGYTNAGKSTLLNALT
FT                   DSAVLAEDKLFATLDPTSRRLRFPRDREVIITDTVGFIRDLPPDLVNAFRATLEELSDA
FT                   DLLLHVVDASDPRHPEQIEAVETILASLGLEQKQRLLVFNKADRLPPGEGAALAHRAEG
FT                   IAVSALSRDGLAELLHLCDRLLWEDRRVAFADVAASAPPPPATPEPGEEGAARAAATDR
FT                   AAPEPTPPSPAARLLPSRIARVS"
     atgcaggacg tcctcggcaa caccctcggc ctcaagccct cccagctcca cgccctccgc        60
     cgcacctacc gccgccgcgt cgacgccgcg tcgatcgtgt cgccggagct cgcccggcac       120
     ctctccgagg tgtcgcgcga gaccaaccgc cagatcggcg tgctcctcga ccgaaagggc       180
     gacgtgcact cggtcatcgt cggcgacgcc cgcaagctcg agctccccga cgtcggccgc       240
     ggccgcgccg gcgagagccg cctgcgcggc ctgcgcctcg tgcacacgca cctgaacggc       300
     gagccgctca cccgcgacga ccacaccgac ctcgccctcc tgcgcctcga cctggtcgcg       360
     gcgatcgagg tccgcgagga cgggctcccg ggcaaggtgc acttcgcgca cctcgtcccg       420
     gagaacgccc agggcgcgat gtggaaggac gaggcggcgg ccagcgtcca cgacctcgcc       480
     tacgacgcgc tctccggcgc gctcgcgctc gaggaggagt tcgcccgcgc ccgggccgtg       540
     cgccgcaccg gcgggcgcga gcgggccatc ctcgtgggct tcggcgggaa ggggcggtcg       600
     cgcgcggacg cggagtcctc gctcgaggag ctgaaggagc tcgcccggac cgcgggggtc       660
     gaggtgatcg acgccaccgt ccagctccgc cgcgatcccg atccgcgcta cctcatcggc       720
     aagggcaagc tcgaggacgt cgtgctgcgc tcgatgcagc tcatggcgac ggtgatcgtg       780
     ttcgacgccg agctctcgcc gtcgcaggcg cgccacatcg cggaggcgac gagcctcaag       840
     atcctggacc gcacccagct catcctcgac atcttcgcgc agcgcgcgca gagcgccgac       900
     ggcaagctcc aggtcgagct cgcccagctg aagtacctct acccgaggct cgtcggccgc       960
     gacgactccc tctcgcgcct cgcgggcggc atcggcggcc ggggccccgg cgagacgaag      1020
     ctcgagatcg atcgccgccg ggtgcgcgac cggatcacgg cgctggagcg gcgcatcgag      1080
     gcgctcggct cgagccgcca gctgcgccgc aagcagcgca acggccgcgg cctgcccgtg      1140
     ctctccatcg tgggctacac caacgccggc aagtccacgc tcctcaacgc gctcaccgac      1200
     tccgcggtgc tcgcggagga caagctgttc gcgaccctcg atccgaccag caggcgcctg      1260
     cgcttcccgc gcgaccgcga ggtcatcatc accgacacgg tcggcttcat ccgcgacctg      1320
     ccccccgacc tcgtgaacgc gttccgcgcc acgctggagg agctctccga cgcggacctg      1380
     ctgctgcacg tcgtggacgc ctccgacccg cgccaccccg agcagatcga ggcggtcgag      1440
     acgatcctgg cctccctcgg cctcgagcag aagcagcggc tgctcgtgtt caacaaggcc      1500
     gaccggctgc cgccgggtga gggcgccgcg ctcgcgcacc gcgcggaggg gatcgcggtc      1560
     tcggcgctct cgcgcgacgg gctcgccgag ctgctgcacc tgtgcgaccg cctgctgtgg      1620
     gaggaccgcc gcgtcgcgtt cgccgacgtc gcggcgagcg cgccgccgcc gcccgcgacg      1680
     ccggaaccgg gcgaggaggg agccgcacgc gcggcagcga cggatcgcgc cgcgcccgag      1740
     cccacaccgc cctcccccgc ggcgcgcctg ctcccttccc ggatcgcgcg cgtgtcgtag      1800
//

If you have problems or comments...

PBIL Back to PBIL home page