(data stored in ACNUC7421 zone)

EMBL: CP000769.PE218

CP000769.PE218       Location/Qualifiers
FT   CDS_pept        251903..252619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0220"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: nha:Nham_3915 HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24438"
FT                   /db_xref="GOA:A7H6U2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U2"
FT                   /protein_id="ABS24438.1"
FT                   /translation="MQRVPHGRAAPTLQDMARPEAVLLDVDGTMVDSVDLHARAWQEAL
FT                   RRFGRDVPLPEVRRQIGKGGDQLVPVFLPPEQLAREGEALERFRAELWRREYMAQVRPF
FT                   PGARALLRRAREAGLRVALASSGSEEEVAHNRRLLDVDALLEGSTTSDDAARSKPHPDI
FT                   FEAALARVRAPPERAIAVGDSPWDALAAGRAGVRTVGLLSGGFEERELREAGCVAIYAG
FT                   PADLLARFDESPLARG"
     atgcagcgcg tgccgcatgg gcgagcagcg cccaccttgc aggacatggc gcggcctgag        60
     gcggtcctcc tcgacgtgga cgggacgatg gtggactcgg tggacctcca cgcgcgcgcg       120
     tggcaggagg cgctccggag gttcggccgg gacgtcccgc tcccggaggt gcggcggcag       180
     atcggcaagg gcggcgacca gctcgtgccg gtgttcctcc ctcccgagca gctcgcccgg       240
     gagggggagg cgctcgagcg gttccgcgcc gagctgtggc ggcgcgagta catggcgcag       300
     gtgcggccgt tcccgggggc gcgcgcgctc ctgcgccgcg cgcgagaggc ggggctgcga       360
     gtggcgctcg cgtcgagcgg cagcgaggag gaggtcgcgc acaaccggcg gctcctcgac       420
     gtcgacgcgc tgctcgaggg gtccaccacc tccgacgacg cggcgcgctc gaagccgcac       480
     ccggacatct tcgaggcggc gctcgcgcgc gttcgcgcgc cgcccgagcg ggcgatcgcg       540
     gtgggcgact cgccctggga cgccctcgcc gcggggcgcg cgggcgtgag gaccgtcggg       600
     ctcctctccg gagggttcga ggagcgcgag ctgcgggagg cgggctgcgt ggcgatctac       660
     gccgggcccg ccgacctgct cgcgcgcttc gacgagtcgc cgctcgcgcg cggctga          717
//

If you have problems or comments...

PBIL Back to PBIL home page