(data stored in ACNUC7421 zone)

EMBL: CP000769.PE219

CP000769.PE219       Location/Qualifiers
FT   CDS_pept        252794..254053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0221"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ade:Adeh_0206 major
FT                   facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24439"
FT                   /db_xref="GOA:A7H6U3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U3"
FT                   /protein_id="ABS24439.1"
FT                   /translation="MATLVSPEAGAPAGARSVLNAAVIVAALGYFVDIYDLILVSIVRK
FT                   PSLTALGVAPELLLTEGFSILNWQMIGMLLGGIVFGVVGDKLGRLQILFGSITLYSLAT
FT                   LANGFVTDLSTYKVLRFVAGLGLAGELGAGVTLVSEILPARLRGYGTMIVASVGVSGAV
FT                   AGNLVAKWLDWRWAYFVGGGLGLVLLVLRIKVHESGMFRKVARQAGISRGDFFSLFTDR
FT                   ERFTRYLASILIAVPIWFANAILVLGAPEFAQALGVTGPVSAGDAVMFFYGGLVVGDVA
FT                   SGSLSQLLRSRRRVVLLFLSLLAAAIAAYFLAGRGASPGLFLALCGLLGVTSGYWAIFV
FT                   TIAAEQFGTNIRATVATTVPNFVRGLVVVVTSTFVWLRPQVGLVGGALAVGAIWFALAL
FT                   GSALRLRETFGIDLDYVERD"
     atggcgaccc tcgtctcccc cgaagccggc gcgcccgccg gcgcgcgctc ggtgctgaac        60
     gccgccgtga tcgtcgcggc gctcggctac ttcgtcgaca tctacgacct catcctcgtc       120
     tcgatcgtgc gcaagccgag cctcaccgcc ctcggcgtcg cacccgagct gctcctcacc       180
     gagggcttct cgatcctcaa ctggcagatg atcgggatgc tgctcggcgg gatcgtgttc       240
     ggggtggtcg gcgacaagct ggggcggctg cagatcctgt tcggctcgat cacgctctac       300
     tcgctcgcga cgctcgcgaa cggcttcgtc acggacctct ccacctacaa ggtgctgcgc       360
     ttcgtcgccg ggctgggcct cgccggcgag ctcggggccg gcgtgacgct cgtgtcggag       420
     atcctgcccg cccggctgcg cgggtacggg accatgatcg tcgcctcggt gggggtctcc       480
     ggggcggtgg cggggaacct cgtggcgaag tggctcgact ggcgctgggc gtacttcgtg       540
     ggcggcgggc tcgggctcgt gctcctcgtc ctgcgcatca aggtgcacga gtcggggatg       600
     ttccggaagg tggcgcggca ggcggggatc tcccgcgggg acttcttctc cctgttcacc       660
     gaccgcgagc gcttcacccg ctacctcgcc tccatcctca tcgccgtgcc gatctggttc       720
     gcgaacgcga tcctcgtgct gggcgcgccg gagttcgcgc aggcgctcgg cgtgaccggg       780
     cccgtctcgg ccggtgacgc ggtcatgttc ttctacggcg ggctcgtggt gggcgacgtg       840
     gcgagcggct cgctctcgca gctcctgcgc agccgccgcc gcgtggtgct cctcttcctc       900
     tccctcctgg cggcggcgat cgcggcctac ttcctcgccg gccggggcgc ctctccgggg       960
     ctgttcctcg cgctgtgcgg gctcctcggc gtgacgagcg gctactgggc catcttcgtc      1020
     accatcgccg ccgagcagtt cgggacgaac atccgcgcca cggtcgcgac cacggtcccg      1080
     aacttcgtgc gcggcctggt ggtggtggtg acctcgacgt tcgtgtggct gcggccgcag      1140
     gtggggctgg tgggcggcgc gctggcggtg ggcgcgatct ggttcgcgct cgccctcggc      1200
     tccgcgctcc ggctgcgcga gaccttcggc atcgacctcg actacgtcga gcgggactag      1260
//

If you have problems or comments...

PBIL Back to PBIL home page