(data stored in ACNUC7421 zone)

EMBL: CP000769.PE223

CP000769.PE223       Location/Qualifiers
FT   CDS_pept        256046..256546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24443"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U7"
FT                   /protein_id="ABS24443.1"
FT                   /translation="MPRLALVAALLLSLAPSARAGTPAPAGRAAAAVELARFALPRATW
FT                   DQTLAAVLGQIEQQAASGGSALPAGFSEALREELGQLFSYEEILDLQAGLLAKHYTEAE
FT                   MQQLVAFYRTPLGQKTIRIMPEVAADAMGQVQVLMGQRVPAMMERLQRRFGPEAAKAKA
FT                   GAK"
     atgccccgcc tcgcgctcgt cgccgccctc ctgctctccc tcgcaccctc cgcccgcgcc        60
     gggacgccgg cgcctgccgg acgcgccgcc gccgccgtcg agctcgcgcg cttcgcgctc       120
     ccgagggcga cctgggatca gacgctggcg gcggtgctgg gtcagatcga gcagcaggcg       180
     gcgagcggag gctccgcgct ccccgccggc ttctcggagg cgctgcggga ggagctcggg       240
     cagctgttct cgtacgagga gatcctcgac ctgcaggccg gcctgctcgc gaagcactac       300
     accgaggcgg agatgcagca gctcgtcgcc ttctaccgga ccccgctcgg acagaagacg       360
     atccggatca tgcccgaggt ggcggcggac gcgatggggc aggtccaggt gctcatgggg       420
     cagcgcgtgc ccgccatgat ggagcggctc cagaggcgct tcggaccgga ggcggcgaag       480
     gcgaaggccg gcgcgaagtg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page