(data stored in ACNUC7421 zone)

EMBL: CP000769.PE224

CP000769.PE224       Location/Qualifiers
FT   CDS_pept        256593..257726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0226"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: ade:Adeh_0211 glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24444"
FT                   /db_xref="GOA:A7H6U8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6U8"
FT                   /protein_id="ABS24444.1"
FT                   /translation="MRSALSRTKRLVVKVGTGTLTDPSGRFDRANCARLGAELAELARR
FT                   RRVVLVSSGAVALGAERLGLARSRGKPWDIPTKQACAAVGQPHLMAAWGDALGAHGVTV
FT                   AQVLLTADDLASRKRFLNARRTFDKLLEAGVVPVVNENDTVAVDEIKVGDNDTLAGLVA
FT                   GCVEAELVAMLTDVEGLYDRNPSEPGASLLHDVPRVTGEIERIAGGAGSERSVGGMATK
FT                   VKAARRLGAQGVTTALLSGRRPRALAALLAGDRVGTVFARGAARLTSRKGWLAAAAKGK
FT                   GVIVVDPGARRALTEQGRSLLPSGVRAVEGHFGVGDPVDIAVDPARPFARGLAGYGADE
FT                   VRRIAGLKTGEIERALGYKYLDEIVHRDDLVVLEARE"
     atgcgcagcg ccctctcccg cacgaaacgg ctcgtcgtca aggtcggcac cggcacgctg        60
     accgacccga gcggccggtt cgaccgggcg aactgcgccc ggctcggcgc ggagctcgcc       120
     gagctcgcgc ggcgccgccg ggtcgtgctc gtctcctcgg gcgcggtcgc gctcggggcc       180
     gagcggctcg ggctcgcccg ctcccgtggc aagccctggg acatccccac caagcaggcc       240
     tgcgccgccg tcggccagcc gcacctcatg gccgcctggg gcgacgcgct cggcgcgcac       300
     ggcgtcaccg tcgcccaggt gctgctcacc gcggacgacc tggcgtcgcg caagcggttc       360
     ctcaacgcgc ggcgcacctt cgacaagctc ctcgaggcgg gcgtcgtgcc ggtcgtgaac       420
     gagaacgaca ccgtcgccgt ggacgagatc aaggtcgggg acaacgacac gctcgccggg       480
     ctggtggcgg gctgcgtcga ggccgagctc gtcgcgatgc tcaccgacgt ggaggggctc       540
     tacgatcgga acccgtcgga gccgggcgcc agcctcctgc acgacgtgcc gcgggtgacc       600
     ggcgagatcg agcgcatcgc gggcggcgcc ggcagcgagc ggagcgtcgg cgggatggcc       660
     accaaggtga aggcggcgcg ccgcctcggc gcgcagggcg tcacgaccgc cctcctctcc       720
     ggccgccggc cccgggcgct cgcggcgctc ctcgcgggcg accgggtggg gacggtcttc       780
     gcgcgggggg cggcccggct cacctctcgc aagggctggc tcgccgcggc cgccaagggg       840
     aagggcgtca tcgtggtgga tcccggcgcg cggcgggcgc tgaccgagca ggggcggtcg       900
     ctgctcccct ccggggtcag ggcggtcgag ggccacttcg gcgtggggga tccggtggac       960
     atcgcggtgg accccgcgag gccgttcgcg cgcgggctcg ccggctacgg cgccgacgag      1020
     gtccgccgca tcgccgggct gaagacgggc gagatcgagc gggcgctcgg gtataagtac      1080
     ctcgacgaga tcgtccaccg ggacgatctc gtcgtcctcg aagcccggga atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page