(data stored in ACNUC7421 zone)

EMBL: CP000769.PE226

CP000769.PE226       Location/Qualifiers
FT   CDS_pept        259027..259602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0228"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein; KEGG: ade:Adeh_0213 iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24446"
FT                   /db_xref="GOA:A7H6V0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V0"
FT                   /protein_id="ABS24446.1"
FT                   /translation="MAIKKKATAKKTAKKTKPLKKTARSRQAPARGGKELARRRGPAPV
FT                   SQALKRVPRAAKKPAASAGGPVSAAPAAAPQPDHARPTALAIAHAGLDKKAEEVTVLDV
FT                   RGLTSYADYFVVMTADSDRQASAIADHVEQTMKAQGVSKVGVEGYETGRWILVDYGDVV
FT                   AHVMNRESRGFYDLEGLWADAPRFAVEG"
     atggcgatca agaagaaggc gacggcgaag aagacggcga agaagacgaa gcccctgaag        60
     aagaccgcga ggtcccgtca ggcgcccgcg cgcggcggga aggagcttgc ccggcgccgc       120
     ggcccggccc ccgtatcgca ggccttgaag cgcgtgcccc gcgccgcgaa gaagccggcc       180
     gcctcggcgg ggggccccgt ctcggcggcg cccgccgccg cgccgcagcc ggatcacgcc       240
     cgcccgaccg cgctcgccat cgcgcacgcc ggcctcgaca agaaggccga ggaggtcacg       300
     gtgctcgacg tgcgcgggct cacgagctac gccgactact tcgtggtcat gaccgccgac       360
     tccgaccggc aggcctcggc catcgcggac cacgtcgagc agaccatgaa ggcgcagggc       420
     gtctccaagg tcggcgtgga gggctacgag accgggcgct ggatcctggt ggactacggc       480
     gacgtggtcg cccacgtcat gaaccgcgag tcgcgcggct tctacgatct cgaggggctc       540
     tgggcggacg cgccgcggtt cgccgtggag gggtag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page