(data stored in ACNUC7421 zone)

EMBL: CP000769.PE227

CP000769.PE227       Location/Qualifiers
FT   CDS_pept        complement(259643..260938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0229"
FT                   /product="cytochrome C family protein"
FT                   /note="TIGRFAM: cytochrome C family protein; KEGG:
FT                   ade:Adeh_0215 multihaem cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24447"
FT                   /db_xref="InterPro:IPR010176"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V1"
FT                   /protein_id="ABS24447.1"
FT                   /translation="MARITLGVALRAAAVTLLVAAACESRAPLPRRQRVEAGPCDTCHA
FT                   APPATGAHLAHVAPAALDGLAYGDLRVLEDVATGGTRYAFGCGHCHPVDEAAHEADLGD
FT                   DGLPDVVLTPPVPLVAGDVIKARNTPQAGWDSASGSCSGVYCHSSGQGHPEAQLEYRAT
FT                   PAWTAAPGTLGCGGCHGNPPGYASSGPGATSAAPNSHIQLAEDGSLAWEWGHYAGMPGP
FT                   YHYPLHGSPTAGFAAAPITCQTCHFETVDPAHTTPGGFYYLDTSGDYALDGGDPARLSH
FT                   PSWARTQCVTCHGEGLRAPAAGGAVLPLRHVNGRPDVAFDRRSALPDGYVTGLPALATT
FT                   APIAPYYVSPFNVSMIGWELPPGSEIRLTETGKEVLTVSLEQASYDPATRTCSNVGCHL
FT                   GRQSMVNAGYPPLQWGEPYVRSVSCDRCHSMF"
     atggcgcgca tcacgcttgg cgtcgcgctc cgcgcggcgg cggtcacgct gctcgtcgcc        60
     gctgcatgcg agtcccgcgc gccgctccct cggcgccagc gggtggaggc cggtccgtgc       120
     gacacgtgtc acgccgcgcc tcccgcgacc ggcgcgcacc tcgcgcacgt ggcgccggcg       180
     gcgctcgacg gcctcgcgta cggcgacctg cgcgtcctcg aggacgtggc gacgggcggg       240
     acgcgctacg cgttcggctg cggccactgc caccccgtcg acgaggccgc gcacgaggcg       300
     gacctcggag acgacgggct ccccgacgtc gtgctcacgc caccggttcc cctcgtcgcg       360
     ggggacgtca tcaaggcgcg caacacgccg caggccggct gggacagcgc gtccggctcg       420
     tgcagcgggg tctactgcca ctcgagcggg cagggtcacc cggaagcgca gctcgagtac       480
     cgcgccacgc ccgcctggac cgcggcgccg ggaacgctcg gctgcggcgg ctgtcacggg       540
     aaccctcccg gctatgcgtc gtccggcccg ggagcgacga gcgccgcccc caactcgcat       600
     atccagctcg ccgaggacgg gagcctcgcc tgggagtggg gtcactacgc cggcatgccg       660
     ggcccctacc actacccgct ccacggcagc ccgaccgcgg gcttcgcggc ggcgcccatc       720
     acctgccaga cctgccactt cgagaccgtg gatcccgcgc acacgacgcc gggcggcttc       780
     tactacctcg acacgagcgg cgactacgcg ctcgacggcg gcgaccccgc gcgcctctcg       840
     catccgagct gggcgcgcac ccagtgcgtc acctgccacg gcgaagggct gcgcgctccc       900
     gcggccggcg gtgcggtgct gccgctgcgc cacgtgaacg gccggccgga cgtcgcgttc       960
     gaccggcgct cggcgttgcc ggacggctac gtgacgggcc tgccggcgct cgcgacgacc      1020
     gcgccgatcg cgccctacta cgtgagcccg ttcaacgtct cgatgatcgg ctgggagctg      1080
     ccgcccggca gcgagatccg gctgaccgaa accgggaagg aggtgctgac cgtctcgctc      1140
     gagcaggcga gctacgatcc cgccacccgc acctgctcga acgtgggctg ccacctgggg      1200
     aggcagtcga tggtgaacgc ggggtatccc cctctgcagt ggggagagcc ctacgtgcgg      1260
     tccgtctcct gcgaccgctg ccactcgatg ttctga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page