(data stored in ACNUC7421 zone)

EMBL: CP000769.PE228

CP000769.PE228       Location/Qualifiers
FT   CDS_pept        complement(261067..261966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0230"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ade:Adeh_0216 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24448"
FT                   /db_xref="GOA:A7H6V2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V2"
FT                   /protein_id="ABS24448.1"
FT                   /translation="MRARIVLVYVAIAFLWGSTWAVIRIGLEHLPPLRFAGIRMALAAA
FT                   ILAPFALRGGAWRVLAGEVGPRVAVVGLFQIAIPYGLMFVAQQWVPSGLAALLFASFPV
FT                   WISLLARVFLPGERLTPAKLASAALGVAGIAVLQWPHLGSLEGSGELALGSALIVSASI
FT                   VVAIANVLVRRHLVAVTPLAMTAGQTFVGAVVLLVAALVFESGRPAAYVPAALAALAYL
FT                   AVFGTALTYIGLYWLVPRVPIAAIGALPLLDTTVAVSLGALLLGESLGWHLALGGAMVL
FT                   AAAALATRDAPRTSDGGA"
     gtgcgcgctc gcatcgtcct cgtctacgtc gccatcgcct tcctgtgggg ctcgacctgg        60
     gccgtcatcc ggatcggcct cgagcacctc ccgcccctgc gcttcgccgg gatccgcatg       120
     gcgctcgcgg cggcgatcct cgcgcccttc gcgctccgcg gcggcgcctg gcgcgtgctc       180
     gcgggcgagg tggggccgcg cgtcgcggtc gtcgggctgt tccagatcgc catcccttac       240
     gggctcatgt tcgtcgcgca gcagtgggtg ccctccggcc tcgccgcgct gctcttcgcg       300
     agcttccccg tctggatctc gctgctcgcc cgggtgttcc tccccggaga gcggctcacc       360
     ccggcgaagc tcgcctccgc ggcgctcggc gtggcgggca tcgcggtgct gcagtggcca       420
     cacctcggct cgctcgaggg ctcgggcgag ctggcgctcg gcagcgccct catcgtctcg       480
     gcctcgatcg tcgtggcgat cgcgaacgtg ctcgtgcgcc gccacctcgt cgccgtcacg       540
     ccgctcgcca tgaccgcggg ccagaccttc gtgggcgccg tcgtgctcct cgtcgccgcg       600
     ctcgtcttcg agtcgggacg cccggccgcg tacgtgcccg ccgcgctcgc cgcgctcgcc       660
     tacctcgccg tcttcgggac ggccctcacc tacatcggcc tctactggct cgtgccgcgc       720
     gtccccatcg ccgccatcgg cgcgctgccg ctcctcgata cgacggtcgc ggtgtcgctg       780
     ggcgcgctcc tgctcggcga gtccctcggc tggcacctcg cgctcggcgg cgcgatggtg       840
     ctcgccgccg ccgcgctcgc cacgcgcgac gccccgcgca cctccgacgg cggcgcctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page