(data stored in ACNUC7421 zone)

EMBL: CP000769.PE230

CP000769.PE230       Location/Qualifiers
FT   CDS_pept        262950..264332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24450"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V4"
FT                   /protein_id="ABS24450.1"
FT                   /translation="MPLSVFVALALSAGAPSAPGACGCPDPETAPTGLLWRGAGPLPPG
FT                   ELARLAAPIVWFSRDEPLVVPGATPPPDPHPCDAEAPRDSPVVYWSLDRVQLRGTDQLA
FT                   RPVEEDARLMERAVSAVFRFFFYYREDVGVGHHPNDIELVDVTVNLVRESGCWEARVRS
FT                   VTGFAHGVDWYSNELAVQPDTRLPITILVEEGKHASCPDRNADGIYTPGYDVNRRINDA
FT                   WGVRDVIGSGFLLSSGYAASMTKPRTPIERVLPPEPGPPCATGRRSSVRDPDAALGRYV
FT                   LRPAREVPICLQAPEPRALEASMRRNHFGLDHEAPQRWFELGDALEQPINGTESLVPSI
FT                   ALRWDGGLGFAALFRGLDLRELYLVPRLSFVGVADALELLVTNSAARFASGYASAGVAR
FT                   EESEWRFVSEAGLKLRVTAKGWQRVLSLGYQFAGLRVGVRSSGFDPLEDLRFVAELGAG
FT                   VW"
     atgccgcttt ccgtgttcgt cgccctcgcg ctctcggccg gggcgccgtc cgcgcccggc        60
     gcgtgcggct gcccggatcc cgagacggcg cccacagggc tactctggcg cggggcgggc       120
     ccgcttccgc ccggcgagct cgcgcgcctc gccgcgccca tcgtgtggtt ctcgcgggac       180
     gagccgctcg tcgttccggg cgcgacgccg ccgcccgatc cccacccgtg cgacgcggag       240
     gccccgcgcg actcacccgt cgtgtactgg tccctcgatc gcgtccagct gcgtggcacc       300
     gaccagctcg cccgacccgt ggaggaggac gcgcgcctca tggagcgggc cgtgagcgcg       360
     gtgttccgct tcttcttcta ttaccgggaa gacgtcgggg tcggtcacca tccgaacgac       420
     atcgagctcg tcgacgtcac ggtgaacctc gtgcgcgagt ccggctgctg ggaggcgcgc       480
     gtgcgatccg tgaccgggtt cgcgcacggg gtcgactggt actcgaacga gctcgccgtg       540
     cagcccgaca cgcggctgcc catcaccatc ctcgtggagg agggcaagca cgcgagctgt       600
     ccggaccgga acgcggacgg gatctacacg cccggatacg acgtgaaccg ccgcatcaac       660
     gacgcgtggg gggtgcgcga cgtgatcggc tcggggttcc tgctctcgag cggctacgcc       720
     gcgtcgatga cgaagccgcg cacgcccatc gagcgggtgc tcccgccgga gcccgggccg       780
     ccgtgcgcga cggggaggcg ctcgtccgtg cgcgaccccg acgcggcgct gggccgctac       840
     gtgctccggc ccgcccgcga ggtgccgatc tgcctccagg cgccggagcc tcgcgcgctc       900
     gaagcctcca tgcgccgcaa ccacttcggc ctcgatcacg aggcgccgca gcgctggttc       960
     gagctcggcg acgcgctcga gcagcccatc aacgggacgg agagcctcgt cccgagcatc      1020
     gcgctccgct gggacggcgg gctcggcttc gcagcgctct tccgcggcct cgacctccgc      1080
     gagctgtacc tcgtgccgcg gctatcgttc gtgggcgtgg ccgacgcgct cgagctgctc      1140
     gtcacgaact cggcggcgcg cttcgcgagc gggtacgcga gcgccggggt ggcgcgcgag      1200
     gagtccgagt ggcgcttcgt ctcggaggcg ggcctcaagc tccgcgtcac cgcgaagggc      1260
     tggcagcgcg tcctcagtct cggctatcag ttcgcgggcc tgcgcgtcgg cgtacgctcg      1320
     agcgggttcg acccgctgga ggacctgcgg ttcgtcgcgg agctgggggc gggagtatgg      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page