(data stored in ACNUC7421 zone)

EMBL: CP000769.PE232

CP000769.PE232       Location/Qualifiers
FT   CDS_pept        264722..265276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24452"
FT                   /db_xref="GOA:A7H6V6"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V6"
FT                   /protein_id="ABS24452.1"
FT                   /translation="MREPARDAGSSCERWGKGITLGRSRARCGDTFAMSRLATSKWVTT
FT                   KRSGRFLDLIVGLFTALLFLIALALGPGVGCDPCVNSVMSEASSPSGDHRAVVFLRNCG
FT                   ATTSYSVELSILRGDERLPTWKGNAFSADAGYSDAPLKLEVHWDSDQALTVRHDPRLRL
FT                   FQNEAKVGPIGLRYVAAESAP"
     gtgcgggagc cggcgcgcga cgcgggctcg tcttgcgaga ggtgggggaa ggggattact        60
     ctcggtcgaa gccgagcgcg gtgcggggac accttcgcga tgagcagact cgccacgagc       120
     aagtgggtca ccacgaagcg ctccggccgc ttcctggacc tgatcgtagg gctgttcacg       180
     gcgctgctct tcttgatcgc gctggctctg gggcccggcg ttggctgcga tccgtgcgta       240
     aactcggtga tgtcggaggc gagctctcct tcgggtgatc accgcgcggt cgtcttcttg       300
     cgtaactgtg gcgcgacgac gtcatacagc gtggagctgt cgatactgcg gggagacgag       360
     cggctgccga cgtggaaggg aaacgcattc agcgccgacg ctggttacag cgatgccccg       420
     ctgaagctcg aggttcactg ggactcggac caggctctga ccgtcaggca cgatccacgc       480
     ctgcgtctct ttcagaacga ggcgaaggtt ggccccatcg gcctgaggta cgtggcggcg       540
     gagagcgctc cgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page