(data stored in ACNUC7421 zone)

EMBL: CP000769.PE233

CP000769.PE233       Location/Qualifiers
FT   CDS_pept        complement(265748..266806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0235"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; tyrosine protein kinase;
FT                   SMART: serine/threonine protein kinase; KEGG: ade:Adeh_0217
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24453"
FT                   /db_xref="GOA:A7H6V7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6V7"
FT                   /protein_id="ABS24453.1"
FT                   /translation="MVRKVGTSRIVREIGRGGMGVVYEAYQDGLERTVAVKSLDTKLAR
FT                   SKEIVERFRREGRAYARLRHEAIVGVHDLVEKDDGLYLVTDLVDGADLARVLATGGALP
FT                   ADCVAVIGARIADALDYVHFNGLLHRDVKPANVMVSRDGEVKLMDFGIAKGADDLSLTK
FT                   AGMLVGSPSYMAPEVLAGEEEGPGADVWALGVTLYELATGEKPFRGKNAEELFAAIARG
FT                   RFRKVRALAPDCPRRLAHAIERCLSRTPAARIASAGALARVLDATAARLVGREVHPRAR
FT                   LVALLANRGYATEEVALSKLDLSTLRATRIADVRGSATAAEFPIRRRAPFRIGLALILA
FT                   LAAGVAAWVVRI"
     atggtgcgca aggtcgggac cagccggatc gtccgtgaaa tcgggcgtgg cggcatgggc        60
     gtcgtgtacg aggcgtacca ggacggcctc gagcgcacgg tcgcggtgaa gtccctcgac       120
     acgaagctcg cccgctcgaa ggagattgtg gagcggttcc gtcgagaagg gcgagcgtac       180
     gcccggctcc ggcacgaggc gatcgtcggc gtgcacgacc tggtcgagaa ggacgacggc       240
     ctctacctgg tgaccgacct cgtggacggc gcggacctcg cccgcgtcct cgcgaccggc       300
     ggggcgctgc cggccgactg cgtcgccgtg atcggcgcgc ggatcgccga cgcgctcgac       360
     tacgtccact tcaacgggct cctccaccgc gacgtgaagc cggcgaacgt gatggtctcg       420
     cgcgacggcg aggtgaagct catggacttc ggcatcgcga agggcgccga cgacctgtcg       480
     ctcaccaagg ccggcatgct cgtggggagc ccgtcgtaca tggcgccgga ggtgctcgcg       540
     ggcgaggagg aggggccggg cgcagacgtg tgggcgctgg gcgtcacgct gtacgagctc       600
     gcgacgggcg agaagccctt ccgcgggaag aacgccgagg agctcttcgc cgccatcgcg       660
     cgcggccgat tcaggaaggt gcgcgccctc gcccccgact gcccccgccg gctcgcgcac       720
     gccatcgagc gctgcctctc gaggaccccg gccgcgcgca tcgcctccgc aggcgcgctc       780
     gcgcgcgtgc tcgacgcgac cgccgcgcgg ctcgtcgggc gcgaggtcca cccgcgcgcc       840
     cgcctcgtcg ccctcctcgc caaccgcggc tacgccaccg aggaggtcgc gctctccaag       900
     ctcgacctct ccaccctgcg cgccacccgc atcgccgacg tgcgcggctc cgccaccgcc       960
     gccgagttcc ccatccgccg ccgcgcgccg ttccgtatcg gactggcgtt gatccttgcg      1020
     ctggcggcgg gggtggcggc gtgggtggtg aggatctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page