(data stored in ACNUC7421 zone)

EMBL: CP000769.PE239

CP000769.PE239       Location/Qualifiers
FT   CDS_pept        279018..279524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0241"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   ade:Adeh_2405 Rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24459"
FT                   /db_xref="GOA:A7H6W3"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W3"
FT                   /protein_id="ABS24459.1"
FT                   /translation="MTERKDRREFLKGLGIGAGVVALGGQSVAALRSLVPNVSYDAPTT
FT                   VKIGAPGEFPDGMKFLPEQRLFVFREGKVFHAISAVCTHLGCTVRAEALPRAETKTVEG
FT                   QPLKLTHRFLCPCHGSRYEGDGQNVAGPAPRPLDWYHLELALDDGQLVVDLAKPVDRDF
FT                   RLTIA"
     atgaccgagc ggaaggatcg gcgggagttc ctgaagggcc tcggcatcgg ggcgggggtc        60
     gtcgccctcg gcgggcagtc ggtcgccgcg ctgcgctcgc tcgtgccgaa cgtctcgtac       120
     gacgcgccca ccaccgtgaa gatcggcgcg cccggcgagt tcccggacgg gatgaagttc       180
     ctgccggagc agcggctgtt cgtgttccgc gaggggaagg tgttccacgc catctccgcc       240
     gtctgcacgc acctcggctg caccgtgcgc gccgaggcgc tgccgcgcgc ggagacgaag       300
     accgtcgagg gacagccgct caagctcacg caccgcttcc tctgcccgtg ccacggctcg       360
     cgctacgagg gcgacgggca gaacgtggcc ggacccgctc cgcgcccgct cgactggtac       420
     cacctcgagc tcgcgctcga cgacggacag ctcgtggtcg atctggcgaa gccggtggac       480
     cgcgacttcc ggctgaccat cgcctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page