(data stored in ACNUC7421 zone)

EMBL: CP000769.PE242

CP000769.PE242       Location/Qualifiers
FT   CDS_pept        282133..284076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0244"
FT                   /product="Nitrous-oxide reductase"
FT                   /EC_number="1.7.2.4"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   ade:Adeh_2402 nitrous-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24462"
FT                   /db_xref="GOA:A7H6W6"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026468"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W6"
FT                   /protein_id="ABS24462.1"
FT                   /translation="MSSSKSVSKPLAIAAVLVAAAAVAVRCAPREPKGARREAAKSDVS
FT                   VAAQKTYVAPGDLDEYYMFSSGGHSGQVFIYGLPSMRHLATIPVFAPYPATGYGFDDET
FT                   KEMLGKLTWGDVHHPALSETKGDYDGRWLFVNEMNGRIARIDLRDFKTRQIIGPVPNVS
FT                   GNHGSAFVTPNTEYAMMSSRFSIPIPKGTAVSIDKYASEYKGIVAGIKIDPESGKMSLG
FT                   WQVALPPFDWDLGDAGKLVSDGWMFLTCYNSERGTGKLEVTASQRDRDYIAAINWREAE
FT                   KAAAEGKGDLIGGVKVLDPRKVPGLVYLMPCGKSPHGVDVSPDGKYIIGSGKLQGVTTA
FT                   FNFEKVLTAIKNKDFTGEEDGIPVLKYESIKDAEVPVGLGPLHTQFGPDGWAYTSLFVD
FT                   SALAKWKLGTWEVVDKVPMSYSTGHLSAAEGDTVSPDGKWLVGLNKLSHGRHLSVGPSQ
FT                   PESSQLVDISEDKMKLVYDAFTEPEPHYAQIIKADKVKPIEVYKKEENKNPLAVWDVKD
FT                   TGASRKGNEVVVKMTAVRSTFTPQLIEVNQGDTVKVAVTNIEQTTDELHGFGLLDYNIN
FT                   LVVDPGETKVVTFKADKPGVFPYYCTNFCSALHQEMQGYLVVRPARAAAPAEGDEGGGA
FT                   RAGREETRRGPR"
     atgtcgtcct cgaagagcgt ctcgaagcca ctcgcgatcg ccgcggtcct ggtcgcggcg        60
     gccgcggtcg cggtgcgctg tgcgcccagg gagccgaagg gagcgaggcg ggaggccgcc       120
     aagtcggacg tctcggtcgc ggcgcagaag acgtacgtcg ccccggggga tctcgacgag       180
     tactacatgt tctcctccgg cggtcactcc ggtcaggtgt tcatctatgg cctcccgtcg       240
     atgcgccacc tcgcgaccat cccggtgttc gcgccgtacc ccgccacggg ctacggcttc       300
     gacgacgaga cgaaggagat gctcgggaag ctcacctggg gcgacgtgca ccacccggcg       360
     ctctccgaga ccaagggcga ctacgacggc cgctggctgt tcgtgaacga gatgaacggc       420
     cggatcgcgc gcatcgatct gcgcgacttc aagacgcggc agatcatcgg gccggtcccg       480
     aacgtctccg ggaaccacgg ctcggcgttc gtcaccccca acaccgagta cgccatgatg       540
     tcctcccggt tctcgatccc catccccaag gggacggccg tctcgatcga caagtacgcg       600
     agcgagtaca agggcatcgt cgcagggatc aagatcgacc cggagtccgg gaagatgtcg       660
     ctcggctggc aggtggcgct cccgccgttc gactgggatc tgggcgacgc cggcaagctc       720
     gtctccgacg ggtggatgtt cctcacctgc tacaactccg agcgcggcac cggcaagctc       780
     gaggtcaccg cgtcgcagcg cgaccgggac tacatcgcgg cgatcaactg gcgcgaggcg       840
     gagaaggccg ctgccgaggg gaagggcgac ctcatcggcg gggtgaaggt gctcgacccg       900
     cgcaaggtgc ccgggctcgt gtacctcatg ccctgcggga agtcgccgca cggcgtggac       960
     gtctcgccgg acggcaagta catcatcggc tcagggaagc tgcagggcgt caccaccgcc      1020
     ttcaacttcg agaaggtcct caccgcgatc aagaacaagg acttcaccgg cgaggaggac      1080
     ggcatcccgg tcctcaagta cgagtcgatc aaggacgccg aggtgccggt ggggctcggg      1140
     ccccttcaca cgcagttcgg cccggacggc tgggcgtaca cctcgctctt cgtcgacagc      1200
     gcgctcgcga agtggaagct cgggacctgg gaggtcgtgg acaaggtccc catgtcgtac      1260
     tcgaccggcc acctctccgc cgccgagggt gacaccgtgt cgcccgacgg gaagtggctc      1320
     gtgggcctga acaagctctc ccacgggcgc cacctgtcgg tggggccgtc gcagcccgag      1380
     tcctcgcagc tggtggacat ctccgaggac aagatgaagc tcgtgtacga cgccttcacc      1440
     gagccggagc cgcactacgc gcagatcatc aaggcggaca aggtgaagcc gatcgaggtc      1500
     tacaagaagg aggagaacaa gaacccgctc gcggtgtggg acgtgaagga cacgggcgcg      1560
     agccgcaagg gaaacgaggt ggtggtgaag atgaccgcgg tgcgctccac cttcacgccg      1620
     cagctcatcg aggtgaacca gggcgacacg gtgaaggtgg cggtgacgaa catcgagcag      1680
     acgacggacg agctgcacgg cttcgggctg ctcgactaca acatcaacct cgtcgtcgat      1740
     cccggcgaga cgaaggtcgt cacgttcaag gccgacaagc cgggcgtgtt cccctactac      1800
     tgcacgaact tctgctccgc gctccaccag gagatgcagg gctacctcgt ggtccggccc      1860
     gcgcgtgccg cggcgccggc cgaaggcgac gagggcggtg gcgcgcgggc cggccgggag      1920
     gagaccagga ggggaccgcg atga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page