(data stored in ACNUC7421 zone)

EMBL: CP000769.PE243

CP000769.PE243       Location/Qualifiers
FT   CDS_pept        284073..284759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24463"
FT                   /db_xref="GOA:A7H6W7"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6W7"
FT                   /protein_id="ABS24463.1"
FT                   /translation="MTRLLESSHRALSSPVGGTPRALVLAAALLLLPTYFLPLWNLTMF
FT                   APQYQGGLRLDIYSYKLEGGNEGQDLKEINLLNHYIGMRDLREDDFREFQWMPFVIGVL
FT                   ALLFLRAIVMGRLLDLVDSTVLFAWFAGFSGWSFAYKLYRYGHDLAPTAPVKVDPFMPP
FT                   LFGGTQLANFEVYSYPAAGSYALLAAGLALVAALLLAARAALREARAARGGTSPAGASS
FT                   ARTAAR"
     atgacgcgcc tgctcgagag cagccaccgc gcgctctcgt cgccggtcgg aggcacgccg        60
     cgggcgctcg tcctcgcggc ggcgctcctg ctcctgccca cctacttcct gccgctctgg       120
     aacctgacga tgttcgcgcc gcagtaccag ggcgggctgc ggctcgacat ctacagctac       180
     aagctcgagg gcgggaacga gggccaggat ctgaaggaga tcaacctcct caaccactac       240
     atcgggatgc gagatctcag ggaggacgac ttccgcgagt tccagtggat gccgttcgtg       300
     atcggcgtcc tggcgctgct cttcctgcgc gcgatcgtga tgggccggct gctcgacctc       360
     gtggactcga cggtcctgtt cgcctggttc gcggggttct ccgggtggtc gttcgcgtac       420
     aagctgtaca gatacgggca cgacctcgcc ccgacggcgc cggtgaaggt ggacccgttc       480
     atgccgccgc tcttcggcgg gacgcagctc gccaacttcg aggtctactc gtaccccgcc       540
     gctggatcgt acgcgctcct cgcggcgggg ctggcgctcg tcgccgccct gctcctcgcg       600
     gcgcgcgcgg cgctccggga ggcgcgggct gcacgcggcg ggacgtcccc ggccggcgcc       660
     tcctcggccc ggaccgccgc acgatga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page