(data stored in ACNUC7421 zone)

EMBL: CP000769.PE247

CP000769.PE247       Location/Qualifiers
FT   CDS_pept        287468..288313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24467"
FT                   /db_xref="GOA:A7H6X1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X1"
FT                   /protein_id="ABS24467.1"
FT                   /translation="MTPPLPSPLLLVARQELLLAARSRWTQIFAAVFAVLALGVAFSGY
FT                   VLSGGSGFQDFARTSASLVQLVALVVPLASLLMGVLSLAPERGTVELLFAQPVARRTIL
FT                   AGKLLGLLAALAAAQAVGFGLAGLVIFSQAGEAGGAGYALLVLGSMVLTAVFLAVAALV
FT                   ASGAVGRKRARAMAVAIVVWFAAVVLFDLAALAIASVLPSGTASRLLAVSVIVNPVGAV
FT                   RTGALLAIEGTAAFGAASLAFLRFTGGEPGAAAALCASLLLWIAVPALLAAWRLGRIDL
FT                   "
     atgacgccgc cgctgccatc tccgctcctg ctcgtcgcgc gccaggagct gctcctcgcg        60
     gcgaggtcgc gctggacgca gatcttcgcg gcggtgttcg ccgtgctcgc cctcggcgtc       120
     gcgttctccg ggtacgtcct ctcgggtggg agcgggttcc aggacttcgc ccggacgagc       180
     gcctcgctcg tgcagctcgt cgcgctggtc gtgccgctgg cgtcgctcct catgggagtc       240
     ctgtcgctcg cgcccgagcg ggggacggtc gagctcctct tcgcgcagcc ggtggcgcgc       300
     cgcaccatcc tcgccgggaa gctgctcggc ctcctcgcgg cgctcgccgc ggcgcaggcg       360
     gtcgggttcg ggctcgcggg cctcgtcatc ttctcgcagg cgggcgaggc ggggggcgcc       420
     gggtacgcgc tgctcgtcct cggatcgatg gtgctcaccg cggtgttcct cgccgtcgcg       480
     gcgctcgtgg cctccggtgc ggtcggccgc aagcgcgccc gcgcgatggc ggtggcgatc       540
     gtggtctggt tcgcggcggt ggtcctcttc gacctcgcag cgctcgcgat cgcctcggtg       600
     ctgccgtcgg ggacggcctc gcggctcctc gccgtctcgg tgatcgtcaa ccccgtgggc       660
     gcggtgagga ccggggcgct cctcgccatc gaggggaccg cggcgttcgg ggccgcgtcg       720
     ctcgccttcc tgcgcttcac gggcggcgag ccgggcgcgg cggcggccct ctgcgcgtcg       780
     ctcctcctct ggatcgccgt gccggcgctc ctcgccgctt ggaggctcgg gcgcatcgat       840
     ctgtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page