(data stored in ACNUC7421 zone)

EMBL: CP000769.PE251

CP000769.PE251       Location/Qualifiers
FT   CDS_pept        291797..292897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0253"
FT                   /product="teichoic acid biosynthesis related protein"
FT                   /note="KEGG: ade:Adeh_0232 teichoic acid biosynthesis
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24471"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X5"
FT                   /protein_id="ABS24471.1"
FT                   /translation="MARILYGVAGEGMGHAIRSRVVIDHLSRSHDVQVVVSGRAHGYLK
FT                   ALERERLGVNRIWGLSIVYEDNEVRNFRTVLANVAGAALGGWPRNVKAYFDLALAFRPD
FT                   VVVSDFESWSHLFARMHGLRCLSVDNNQIVNRADHPPEITAGHEAEYLVAKAVVKAKLP
FT                   GCFHYLVATFFQPEAVKRRTTLHPPVLRPEILAARPEPGDHLLVYQTSTSNEALPDVLR
FT                   RSGRECRIYGLRRDLTSDERDGNLLWRPFDEPAFIEDLRTARAVVSGGSFTLMSEAVYL
FT                   HKPMLAVPVKRQFEQLLNARYLERLGYGAAAELIDDAVLAAFLGRLPELERRLAAYRQD
FT                   GNRDLLAKLGETIARALVPGDVGPLP"
     gtggcgcgca tcctctacgg cgtggcgggc gagggcatgg ggcacgcgat ccgctcgcgc        60
     gtcgtcatcg accacctctc ccgctcgcac gacgtgcagg tggtcgtctc gggccgcgcg       120
     cacggctatc tcaaggcgct ggagcgagag cgcctggggg tgaaccggat ctggggcctc       180
     tcgatcgtct acgaggacaa cgaggtgcgg aacttccgga ccgtcctcgc gaacgtcgcg       240
     ggggcggccc tgggcggctg gccgcgcaac gtgaaggcgt acttcgacct cgccctggcg       300
     ttccggccgg acgtcgtggt ctccgacttc gagagctgga gccacctgtt cgcgcggatg       360
     cacgggctca ggtgcctctc ggtggacaac aaccagatcg tgaaccgcgc cgatcacccg       420
     ccggagatca ccgccgggca cgaggccgag tacctcgtcg cgaaggccgt cgtgaaggcg       480
     aagctgcccg gctgcttcca ctacctcgtc gcgacgttct tccagccgga ggccgtgaag       540
     cgccgcacga cgctccaccc gccggtgctg cgccccgaga tcctcgccgc ccgcccggag       600
     cccggcgacc acctcctcgt ctaccagacc tccacgtcga acgaggcgct ccccgacgtc       660
     ctgcgccgct cggggcggga gtgccgcatc tacgggctgc gccgcgacct cacctccgac       720
     gagcgcgacg gcaacctcct gtggcggccc ttcgacgagc ccgccttcat cgaggacctg       780
     cgcaccgccc gcgcggtcgt ctcgggcgga tccttcacgc tcatgagcga ggcggtgtat       840
     ctccacaagc ccatgctcgc cgtccccgtg aagcgtcagt tcgagcagct cctgaacgcc       900
     cgctacctcg agcggctcgg ctacggcgcc gccgccgagc tcatcgacga cgccgtcctc       960
     gcggcgttcc tcgggcgcct ccccgagctc gagcggcgcc tcgccgcgta ccgccaggac      1020
     gggaaccgcg acctcctcgc caagctcggc gagacgatcg cgcgggcgct cgtccccggc      1080
     gacgtcggcc cactcccctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page