(data stored in ACNUC7421 zone)

EMBL: CP000769.PE252

CP000769.PE252       Location/Qualifiers
FT   CDS_pept        292906..293367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0254"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163; KEGG:
FT                   ade:Adeh_0233 protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24472"
FT                   /db_xref="GOA:A7H6X6"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H6X6"
FT                   /protein_id="ABS24472.1"
FT                   /translation="MRLRVVAVGRDRSGLYAPAIEEYAKRLGRYVKFELVEVPEARKHA
FT                   GTAQARDEEAEALLAKLGPRERVIALDERGAEWTSVAFAERVRRWTEGGRDVALVIGGS
FT                   DGLSRAVLDRAEETLALSRMTLAHRLARLVLVEQLYRAMTILRGEPYHK"
     atgcgcctcc gcgtcgtcgc cgtcggcagg gatcgctccg ggctctacgc gccggcgatc        60
     gaggagtacg cgaagcgcct cggtcgctac gtgaagttcg agctcgtgga ggtccccgag       120
     gcgaggaagc acgccggcac cgcccaggcg agggacgagg aggcggaggc gctcctcgcg       180
     aagctgggcc cgcgcgagcg ggtcatcgcc ctcgacgagc ggggcgcgga gtggacgagc       240
     gtcgccttcg cggagcgggt gcggcgctgg accgagggcg ggcgggacgt ggcgctcgtc       300
     atcggcggct ccgacggcct gtcgcgcgcg gtgctggacc gcgccgagga gacgctggcg       360
     ctctcgcgga tgacgctcgc ccaccggctc gcgcggctcg tcctcgtcga gcagctgtac       420
     agggcgatga cgatcctgag gggagagccg taccacaagt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page