(data stored in ACNUC7421 zone)

EMBL: CP000769.PE254

CP000769.PE254       Location/Qualifiers
FT   CDS_pept        293951..294682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_1717 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24474"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6X8"
FT                   /protein_id="ABS24474.1"
FT                   /translation="MSPWNVAQVATGRYLCHRARRGDQGSQEQAERVRPSRLAGGDGPH
FT                   RRSRPRRGGARPGRSAPERDGVRRGARRPRPPRRRDARAHAAGRPSRGASQDGAPRGAP
FT                   RGAGRRSRGPMIYLDTSVALAELFAEDRRAPDALWAEALVSSRLLEYELWTRIHARGAA
FT                   RTHDGPAREVLARVSFVELARPVLARALEPFPAPVRTLDALHLATVHYLAEAGQRVAVA
FT                   TFDARMAEAARRMSYPLAFAP"
     gtgtcgccct ggaacgttgc gcaagtagct accgggcgct acctttgcca tcgtgcgcgt        60
     cgtggggatc aaggttctca agaacaagct gagcgagtac gtccgtctcg cctcgcaggg       120
     ggagacggtc ctcatcgccg atcgcgaccg cgtcgtggcg gagctcgtcc cggccgatcc       180
     gcgccggagc gagatggtgt ccgacgcggc gctcgccgac ctcgtccgcc gcggcgtcgt       240
     gacgcccgcg ctcatgccgc cgggcgcccg tcccgcggcg cctcccagga cggtgcgcct       300
     cgcggagctc ctcgcggagc tggacgccga tcgcgcggac cgatgatcta cctcgacacg       360
     tccgtcgcgc tcgccgagct cttcgcggag gaccgccggg cgcccgacgc gctctgggcg       420
     gaggcgctcg tgtcgagccg cctgctcgag tacgagctct ggacgaggat ccacgcgcgc       480
     ggtgctgccc ggacgcacga cggtccggcg cgggaggtgc tcgcccgcgt gtcgttcgtc       540
     gagctcgcgc gtccagtgct cgcgcgcgcg ctcgagccgt tccccgcgcc cgtgcggacg       600
     ctcgacgcgc tgcacctcgc gacggtccac tacctcgccg aggccggaca gcgcgtggcg       660
     gtcgctacgt tcgacgcccg catggccgag gccgcgcgga ggatgagcta cccgctcgct       720
     ttcgcgccct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page