(data stored in ACNUC7421 zone)

EMBL: CP000769.PE257

CP000769.PE257       Location/Qualifiers
FT   CDS_pept        297168..300929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0259"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein; KEGG:
FT                   ade:Adeh_0237 tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24477"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y1"
FT                   /protein_id="ABS24477.1"
FT                   /translation="MSRPLAALLALAVVAPLPVARAAGGAPGARGADPEAALRAEAIAA
FT                   LARDRRGPRGIVALAELGELEAEAPELAPLAAAYAAAVEDRAAHPEVRALARHRLAALE
FT                   RSRGNFQRSAAQVRRLGFVTRWHVVGPFDDEGKRGLDTAYAPEQGIDLAARHDGKVGEV
FT                   AWRPLPDEAVVHGFVDLGAALRPASEGVAYAVAFVEAARDERVALWLGASGAAKVWVNG
FT                   AVVVADAGYHPARLDQRGAVVTLRRGTNRILVKLCHQLGRMGFFLRLADERGDGRARAA
FT                   GSPDAPAPEPGPAASPIDGAVARLEAQARGARTRAEEAAARRDLAIVLAERQSADFEER
FT                   RPAAEARRAAELAPRSAELQLLAASMEEDHGRRRRYVEAALAARPEEPRALAALAREEL
FT                   DQGRPHAALRLLDRAVAAAPRWAAPRVARVEALDRAGLEVRAVRAAAEAADAFPTTPGA
FT                   VRAAARAAGRLNRVEEAVARLRTLLALRLDDAEARGTLAHLLVERGEVATAAALLAEAL
FT                   RLDPAAGEQRLRLADLLAANGRGEEAEAAYEAALRIAPADADALERRGRARLAAGRPRD
FT                   ALQDLHAALDLRPQSPELKELVRSLEPARERFEAPYVLDARALAANAPAPRADDDAIVL
FT                   GELKVTRVFPSGLSATFHQQVVKIVSARGAEAFRRHVIGWTPDRQDVRVERVRIVKPDG
FT                   SSVETHDAAERSASEPWYRLYYDTRTRTLSFPSLGAGDVLEVAWRIEDSARENLLSDYF
FT                   GDLTFLDDTTRKARVDYVLLVPEARPIYSSVPEGVRHETRKLSGGLVEHRFAARELARI
FT                   RPEPGMPGWSEVARYVHVSTYGDWDQVARFYWGLVKDQLRPTDELRATSARIVEAAVGA
FT                   TRLQPVAARAGGAAPAAQGGWTLDQKRAIARGVYDFVVSQTRYVGLEFGIHGYKPYRVD
FT                   QVLARRFGDCKDKASLVHALLASAGIDSRLVLLRMRRLGRMPEAPASLAVFNHAIVYVP
FT                   ELDLWLDGTAAHSGSGDLPSEDRGATVLVVNPGGKARFGTVPQARPEDNRLESRFEVTL
FT                   GADGRARVRGSSRVRGSQAPQYRRAYLAEHERRAQLERAFGRTFPGAEVTGLSVSDLTR
FT                   IEEDVAMEFTLDVPRYALADGGGLRFTPFGDVAGYAQSYAALSARRYDLVVGDPGITRF
FT                   TYRYVLPAGWAPVEVPEPAAADTPHGAFEVRYRREGDALVAEGHVTFKAARVAAAEYPA
FT                   FRDLAARIDRAFARKVRIAPAAAGEGSR"
     atgtctcgcc ccctcgccgc cctgctcgcg ctcgccgtgg tcgcccccct ccccgtcgcc        60
     cgtgccgccg gaggggcgcc tggcgcgcgc ggagcggatc ccgaggccgc gctccgcgcc       120
     gaggcgatcg cggcgctggc gcgggaccgg cgcgggccgc gcgggatcgt cgcgctcgcc       180
     gagctcggcg agctcgaggc cgaggcgccg gagctcgcgc ccctcgccgc cgcctacgcc       240
     gccgccgtcg aggaccgcgc ggcccacccc gaggtccgcg cgctggcgcg ccaccggctg       300
     gccgccctgg agcgctcgcg cgggaacttc cagcgcagcg ccgcgcaggt gcggcggctc       360
     gggttcgtga cgcgctggca cgtcgtcggc ccgttcgacg acgagggcaa gcgcgggctc       420
     gacaccgcct acgcgccgga gcaggggatc gatctcgccg cccgccacga cggcaaggtc       480
     ggcgaggtcg cgtggcgccc gctgccggac gaggccgtcg tgcacggctt cgtggatctc       540
     ggcgccgccc tccggcccgc cagcgagggg gtcgcctacg ccgtggcttt cgtggaggcg       600
     gcgcgcgacg agcgcgtggc cctgtggctc ggcgcgagcg gcgccgcgaa ggtgtgggtg       660
     aacggcgcgg tcgtcgtcgc cgacgccggc taccacccgg cgaggctcga ccagcgcggc       720
     gccgtggtga cgctgcgccg gggcacgaac cgcatcctcg tgaagctgtg ccatcagctc       780
     ggccgcatgg gcttcttcct gcggctcgcc gacgagcgcg gcgacggtcg tgcccgcgcg       840
     gcgggctcgc ccgacgctcc cgcccccgag cccgggcccg cggcttcccc gatcgacggc       900
     gcggtggcgc ggctcgaggc gcaggcccgc ggggcgagga cgcgggcgga ggaggccgcg       960
     gcgcggcggg acctcgccat cgtcctcgca gagcggcaga gcgcggactt cgaggagcgg      1020
     cggcccgccg cggaggcgcg gcgcgcggcg gagctggcgc cgcgctcggc ggagctgcag      1080
     ctcctggcgg cctcgatgga ggaggaccac gggcggcggc gccgctacgt ggaggcggcg      1140
     ctcgccgcca ggcccgagga gcctcgcgcg ctcgccgcgc tggcgcgcga ggagctggat      1200
     cagggacggc cccacgcggc gctgcggctc ctcgatcgcg cggtggccgc cgcgccgcgc      1260
     tgggccgcgc cgcgcgtcgc gcgggtcgag gcgctcgatc gcgccggcct ggaggtgcgc      1320
     gcggtccgcg ccgcggcgga ggccgcggac gccttcccca ccacccccgg cgcggtgcgc      1380
     gccgcggcgc gcgcggcggg ccggctgaac cgcgtcgagg aggccgtggc gcggctgcgg      1440
     accctgctcg cgctgcggct cgacgacgcc gaggcgcgcg gcacgctcgc ccacctgctc      1500
     gtggagcgcg gcgaggtcgc gaccgcggcg gcgctcctcg cggaggccct caggctcgat      1560
     cccgccgccg gcgagcagcg gctccgcctc gcggacctgc tcgccgcgaa cggacgcgga      1620
     gaggaggcgg aggccgcgta cgaggcggcg ctgcgcatcg cccccgccga cgcggacgcc      1680
     ctcgagcgcc gcggccgggc gcggctcgcc gccgggcgtc cccgcgacgc gctccaggac      1740
     ctgcacgccg cgctcgacct ccgcccccag tcgccggagc tgaaggagct cgtgcggagc      1800
     ctcgagccgg cccgcgagcg gttcgaggcg ccctacgtcc tcgacgcacg cgcgctcgcc      1860
     gcgaacgcgc ccgcgccgcg cgccgacgac gacgccatcg tgctcggcga gctcaaggtg      1920
     acgcgcgtct tcccctccgg gctgtccgcc acgttccacc agcaggtggt caagatcgtg      1980
     agcgcccgcg gggcggaggc gttccggcgg cacgtcatcg gctggacgcc ggatcggcag      2040
     gacgtccgcg tcgagcgcgt gcggatcgtg aagcccgacg gcagcagcgt cgagacgcac      2100
     gacgcggcgg agcggagcgc gagcgagccg tggtaccggc tgtactacga cacgcgcacc      2160
     cgcaccctgt ccttcccgtc gctcggggcc ggcgacgtcc tcgaggtcgc ctggcgcatc      2220
     gaggacagcg cccgcgagaa cctgctctcg gactacttcg gcgatctcac cttcctcgac      2280
     gacaccaccc gcaaggcgcg cgtcgactac gtgctgctcg tccccgaggc gcggcccatc      2340
     tactcgagcg tgcccgaggg cgtgcgccac gagacgcgca agctgtccgg cgggctcgtc      2400
     gagcaccgct tcgccgcccg ggagctcgcg cgcatccggc ccgagcctgg catgcccggc      2460
     tggagcgagg tcgcccgcta cgtccacgtc tccacctacg gcgactggga ccaggtggcc      2520
     cgcttctact gggggctcgt gaaggaccag ctgcgcccca cggacgagct ccgcgccacc      2580
     tccgcgcgga tcgtggaggc ggcggtcggc gcgacccggc tccagcccgt cgcggcgcga      2640
     gcgggagggg cggcccccgc ggcccagggc ggctggacgc tggaccagaa gcgggccatc      2700
     gcccgcggcg tctacgactt cgtcgtctcg cagacgcgct acgtgggcct cgagttcggg      2760
     atccacggct acaagcccta ccgggtggat caggtgctgg cgcgacgctt cggcgactgc      2820
     aaggacaagg cgagcctcgt ccacgcgctc ctcgccagcg cggggatcga ctcgcggctc      2880
     gtgctcctgc gcatgcggcg gctcggccgc atgccggagg cgcccgcgtc gctcgccgtg      2940
     ttcaaccacg ccatcgtgta cgtgcccgag ctcgacctgt ggctcgacgg caccgccgcc      3000
     cactccggct ccggcgatct gccgagcgag gaccgcggcg cgaccgtgct ggtggtgaac      3060
     cccggcggga aggcgcgctt cggcacggtc ccgcaggcgc gccccgagga caaccgcctg      3120
     gagagccgct tcgaggtgac gctcggggcg gacggccgcg cgcgcgtgcg agggagctcg      3180
     cgcgtccgcg gctcgcaggc gccgcagtac cggcgcgcct acctcgccga gcacgagcgg      3240
     cgcgcccagc tcgagcgggc cttcggccga accttcccgg gcgccgaggt gaccggcctc      3300
     tccgtctcgg acctcacccg catcgaggag gacgtcgcga tggagttcac cctcgacgtg      3360
     ccgcgctacg cgctcgccga cgggggcggc ctccgcttca cgccgttcgg cgacgtggcg      3420
     gggtacgccc agtcgtacgc cgcgctctcc gcccgcaggt acgatctcgt ggtcggggat      3480
     ccggggatca cgcgcttcac ctatcgttac gtcctgcccg cgggctgggc gccggtcgag      3540
     gtgcccgagc ccgccgccgc cgacacgccg cacggcgcgt tcgaggtgcg ctaccgccgc      3600
     gagggcgacg cgctcgtcgc cgaggggcac gtcaccttca aggcggcgcg cgtcgcggcg      3660
     gcggagtacc ccgcgttccg cgacctcgcc gcgcggatcg accgcgcctt cgcgcggaag      3720
     gtccgcatcg ctcccgccgc ggcgggggag ggctcgcgat ga                         3762
//

If you have problems or comments...

PBIL Back to PBIL home page