(data stored in ACNUC7421 zone)

EMBL: CP000769.PE258

CP000769.PE258       Location/Qualifiers
FT   CDS_pept        300926..304651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24478"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y2"
FT                   /protein_id="ABS24478.1"
FT                   /translation="MTARLRRPCALAAAVLLAALGCAGPRAGSPGPGASGNARPAEALV
FT                   LRNDAAAAQAGTSRALARRGEDPWAHLGAALLARRALDAAAEGRHLLAVAAAAPADPAA
FT                   LVALRRLSELAEESPARAGEVEAGLAPLLEAGRFTGLAAYRARIARVTAAEVRGDHARA
FT                   VALRRANGAVTAWSLAGPFGRYQALDLDARFPPDEGVLPEAAPAPAGLPPRPTRALPAP
FT                   DGTVTLEGEPPDADVFYLASDVTLARGGRYLLTVGTGLSARVSIDGGPVHERRAFAGTP
FT                   ASLAHLPLELAPGPHRVLVKLTRGPSSRSGLHVALTREDGAPSDAAFTPAAPGAAPRAP
FT                   VPPRAGPPVGAPDGLASALEPAGGYALAQLLAARDAAQVDREGAKALLARAVARLPSSA
FT                   ALRVARATVVQDDDTLDSQAGRARAEADLREALARDPGHAEARVLLAELLRRSERLDDA
FT                   DALLAGLSPAAAGRGAALEARARAAEARGLGVRAEQLAAEALSESGRCGAADLAYALAG
FT                   RRLAIAEEDARIRAVAACRDGAARLAEHLRRRGDARGAVEALASTVAARPWAIEPALTR
FT                   AGALVAAGDAAGAVEALGALQAVWPRSPRVAKKLADVRELAGDLPGARALRERALLLDG
FT                   ADLALRRALALEDGREVLDAGAQDGRAAIRAYERARPRGATSAAMVLDAAAIELHPGGS
FT                   ATERTHQVIHVLDQQGVEEFGEISVPHGADVLQLHTVKPDGRALEPERAGASKGSVSLA
FT                   GLEPGDYVEVEHVRAVRGLGGAYVSDPFYFQVAGVPLFHSSYLVVAPEGLGLAVDAHGM
FT                   PAPEVRREGGRDVVRGLRTEVPAFVPEPGAVPPQEYLPFVQVGAGADRADVQRALGDAV
FT                   LERTRPTEELRAFARALRAEAGRDASPEALARAAYARVARDILGTGSALGEDASVVLSR
FT                   GRGSRLVVLKAVLSELGLRTRIALARPFSADAVAYRFPNPAEFTHPLLRVQAGAETFWL
FT                   DPALRLAPFGAVPSSVLDVDAMVLPEPGDAMEVARTPARAQVEERREVAVHIALRPDGA
FT                   GEVQGSDRYFGAMAAAAKEGLEKLDATERRQAVEAMLSRTFGGVTVQEVTIGGEDEPAA
FT                   PLEIRWRGTVPDLARASGGGMVMDASLFPARLASRYVQIAQRRTPLLLPTPEVGVSKIE
FT                   IAVPEGLAIRASPARKVETPFGTFTRTERAEGRTLVREDRLAVTRGRVPPERYGEFAAF
FT                   AAAVDAIQDDPAVFHR"
     atgacggccc gcctccgtcg cccctgcgcc ctcgcggccg cggttctcct ggccgcgctc        60
     ggctgcgccg ggccccgggc cggctccccc ggaccgggcg cgtcgggcaa cgcccgtccg       120
     gccgaggcgc tcgtcctccg caacgacgcc gccgccgcgc aggcgggcac ctcccgggcc       180
     ctcgcgcgcc ggggcgagga cccgtgggcg cacctcggcg ccgcgctcct cgcccgccgc       240
     gcgctcgacg cggccgcgga gggtcgccac ctcctcgccg tcgccgccgc cgcgcccgcc       300
     gatcccgccg cgctcgtggc gctgcggcgc ctctccgagc tcgcggagga gtccccggct       360
     cgcgccggcg aggtggaggc gggcctcgcg ccgctcctcg aggccggccg gttcacgggc       420
     ctcgccgcgt accgggcgcg catcgcgcgg gtgaccgccg cggaggtccg gggcgaccac       480
     gcgcgggcgg tcgcgctgcg ccgcgcgaac ggcgccgtga ccgcctggtc gctcgccgga       540
     ccgttcggcc ggtaccaggc gctcgacctc gacgcgcgct tcccgccaga cgaaggcgtc       600
     ctgccggagg ccgcgccggc gccggcgggg ctgccgccgc ggccgacccg cgcgctcccc       660
     gcgccggacg gcaccgtcac gctggagggc gagccgcccg atgcggacgt gttctacctc       720
     gcctccgacg tgaccctcgc ccgcgggggc cggtacctgc tcacggtcgg tacgggcctg       780
     tcggcgcgcg tctccatcga cggcgggccg gtccacgagc ggcgtgcgtt cgcggggacc       840
     ccggcgtcgc tcgcccacct tccgctcgag ctcgcgccgg gtccccaccg cgtgctcgtg       900
     aagctcacgc gcggcccctc ctcccgcagc ggcctccacg tcgcgctcac gcgcgaggac       960
     ggcgccccct cggacgcagc cttcacgccg gccgcgccgg gggccgcgcc gcgggcgccc      1020
     gtccccccgc gcgcgggccc gccggtgggc gcccccgacg gcctcgcgtc cgccctcgag      1080
     cctgccgggg gctacgccct cgcgcagctg ctcgcggcgc gcgacgcggc gcaggtggat      1140
     cgcgagggag cgaaggcgct cctcgcccgc gcggtggcgc gcctgccgag ctccgccgcg      1200
     ctgcgcgtgg cgcgggccac cgtcgtccag gacgacgaca cgctcgactc ccaggccggc      1260
     cgcgcgcgcg ccgaggccga tctgcgcgag gcgctcgcgc gcgatcccgg gcacgccgag      1320
     gcgcgcgtgc tgctcgccga gctgctccgg cgctccgagc ggctcgacga cgcggacgcc      1380
     ttgctcgcgg ggctctcgcc ggcggccgcg ggccggggcg cggcgctcga ggcccgggcc      1440
     cgcgcggccg aggcgcgggg gctgggagtc cgggccgagc agctcgccgc ggaggcgctc      1500
     tccgagagcg gccgctgcgg cgcggccgac ctcgcctacg cgctcgccgg tcgccggctc      1560
     gccatcgcgg aggaggacgc ccggatccgc gcggtcgccg cctgccgcga cggggcggct      1620
     cgcctcgcgg agcacctgcg ccggcgcggg gacgcgcgcg gcgcggtcga ggcgctcgcg      1680
     tcgacggtgg cggcgcgacc gtgggcgatc gagccggccc tcacccgagc gggcgcgctc      1740
     gtcgcggcgg gcgacgccgc cggcgcggtc gaggcgctcg gcgccctcca ggcggtctgg      1800
     ccgcggagcc cgcgcgtcgc gaagaagctc gcggacgtgc gcgagctcgc cggcgatctc      1860
     ccgggcgcgc gcgcgctgcg cgagcgggcg ctgctcctcg acggggcgga cctcgcgctg      1920
     cgccgggccc tcgcgctgga ggacgggcgc gaggtgctcg acgccggcgc ccaggacggc      1980
     cgcgcggcga tccgcgcgta cgagcgggcg cgcccccgcg gggcgacctc ggcggcgatg      2040
     gtgctcgacg cggcggcgat cgagctccac cccggcggct ccgccacgga gcggacgcac      2100
     caggtgatcc acgtcctcga tcagcagggc gtcgaggagt tcggcgagat ctccgtcccg      2160
     cacggcgcgg acgtgctcca gctccacacg gtgaagcccg acgggcgcgc gctcgagccc      2220
     gagcgggcgg gcgcgtcgaa ggggtcggtg tcgctcgccg gcctcgagcc gggggactac      2280
     gtcgaggtgg agcacgtgcg cgcggtgcgc gggctgggcg gcgcgtacgt gtccgacccg      2340
     ttctacttcc aggtcgccgg cgtgccgctc ttccactcct cgtacctcgt cgtcgcgccc      2400
     gaggggctcg ggctcgccgt ggacgcgcac ggaatgcccg cgccggaggt gcggcgcgag      2460
     ggggggcggg acgtcgtgcg cggcctgcgg accgaggtcc cggccttcgt cccggagccc      2520
     ggcgcggtgc cgccgcagga gtacctgccg ttcgtgcagg tgggcgccgg cgcggaccgg      2580
     gcggacgtcc agcgcgcgct cggcgacgcg gtgctcgagc gcacccggcc gaccgaggag      2640
     ctccgcgcgt tcgcgcgcgc gctcagggcc gaggcgggcc gcgacgcctc gccggaggcg      2700
     ctggcgcggg ccgcctacgc gcgcgtcgcg cgcgacatcc tggggacggg cagcgcgctc      2760
     ggcgaggacg cgagcgtggt gctgtcgcgc ggtcgcggca gccggctcgt ggtgctgaag      2820
     gcggtgctct ccgagctcgg gctgcggacc cgcatcgcgc tcgcccgccc gttctcggcg      2880
     gacgccgtcg cctaccggtt cccgaacccc gccgagttca cgcacccgct cctccgggtc      2940
     caggcgggag cggagacctt ctggctcgac cccgcgctcc ggctcgcgcc cttcggcgcg      3000
     gtgccgtcga gcgtgctcga cgtggacgcg atggtgctgc cggagccggg cgacgcgatg      3060
     gaggtggccc gcacgcctgc gcgcgcgcag gtcgaggagc ggcgcgaggt cgccgtgcac      3120
     atcgccctgc gcccggacgg cgccggcgag gtgcagggga gcgatcgcta cttcggggcc      3180
     atggcggccg cggcgaagga agggctcgag aagctcgacg cgaccgagcg gcgccaggcc      3240
     gtcgaggcga tgctctcgcg gaccttcggc ggggtcaccg tgcaggaggt gaccatcggc      3300
     ggcgaggacg agccggcggc gccgctcgag atccgctggc gcgggaccgt gccggacctg      3360
     gcccgcgcgt ccggaggcgg gatggtgatg gacgcgtcgc tcttcccggc gcggctcgcg      3420
     tcgcgctacg tgcagatcgc gcagcgtcgc acgccgctcc tgctgcccac gccggaggtg      3480
     ggcgtgtcga agatcgagat cgccgttccg gaggggctcg cgatccgggc ctcgccggcg      3540
     cggaaggtgg agacgccgtt cggcaccttc acgcggaccg agcgcgccga ggggaggacg      3600
     ctcgtgcgcg aggaccggct cgccgtgacg cgcgggaggg tcccacccga gcggtacggc      3660
     gagttcgccg ccttcgccgc ggcggtggac gcgatccagg atgacccggc ggtgttccac      3720
     cgctga                                                                 3726
//

If you have problems or comments...

PBIL Back to PBIL home page