(data stored in ACNUC7421 zone)

EMBL: CP000769.PE259

CP000769.PE259       Location/Qualifiers
FT   CDS_pept        complement(305306..305920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24479"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y3"
FT                   /protein_id="ABS24479.1"
FT                   /translation="MRRLLGLAVLGLSLGAGLAVMFRVLPSDRPMPAPPAVATQIREVA
FT                   RLETLEVRLYKKVSFAPEPTPAGSFWGDVAGWLRHAVSAPQGKAIVFADAYLTLDLERL
FT                   NANSVQVEGRRVDVVLPPIRTTVALRPGETEVLGSNLDSADTARLLELAKAAFEREVDA
FT                   DAALQARARASAERHIRALLLSLGFEDVRFVDVLPPARSQT"
     atgcgccgcc tcctcggcct cgccgtcctg ggactctcgc tcggcgccgg cctcgccgtg        60
     atgttccgcg tgctgccgag cgaccgtccg atgcccgctc ctccggcggt cgcgacgcag       120
     atccgcgagg tggcgcggct cgagaccctc gaggtgcggc tctacaagaa ggtgagcttc       180
     gcgccggagc ccacgccggc cggctcgttc tggggcgacg tcgccggctg gctgcgccac       240
     gcggtgagcg cgccgcaggg gaaggccatc gtcttcgcgg acgcctacct gaccttggac       300
     ctcgagcggc tgaacgcgaa cagcgtccag gtggaagggc gccgcgtgga cgtggtgctg       360
     ccccccatcc gcaccaccgt cgcgctccgc cccggcgaga ccgaggtcct cggctccaac       420
     ctcgactcgg ccgacacggc gcggctgctc gagctcgcga aggccgcctt cgagcgcgag       480
     gtcgacgccg acgccgcgct gcaggcgcgc gcgcgcgcgt cggccgagcg gcacatccgg       540
     gcgctgctgc tctcgctcgg cttcgaggac gtccgcttcg tggacgtgct cccgcccgcg       600
     cgctcgcaga cgtag                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page