(data stored in ACNUC7421 zone)

EMBL: CP000769.PE26

CP000769.PE26        Location/Qualifiers
FT   CDS_pept        30632..33085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0026"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   chu:CHU_2794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24246"
FT                   /db_xref="GOA:A7H6A0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A0"
FT                   /protein_id="ABS24246.1"
FT                   /translation="MRGPHQLEFRETAQSPRPRPAGPPGFEHAPPDPDRVLRPGHEGNR
FT                   WRPEAFAAGDPAARERLAARVVEGGLAVHDTLREQLVELLETREPARELEPAELGERLA
FT                   AHLEGAPLAHHGTWFLYPWSRRVVHVLPEDEFRELRASRNRNKISSEEQERLRALRLGV
FT                   IGLSVGSASAVALAMEQVGGELYLADHDRLSLSNLNRLRAGVHEIGLPKAVLTARAIAE
FT                   LDPYLRVRPFLDGITDGNMDAFLRPGGRPLDLLVEECDDLYVKVRVREAARALRIPVLM
FT                   ETSDRGLLDVERFDLEPGRPVLHGLVGAIDAERLRGLDTSEKVPIVLRILGERSISPRL
FT                   AASLVEVKATLKTWPQLASAVSLGAAVVTDAARRIALGQLTSSGRFYVDLDELVRDGAG
FT                   AALPGLQDPPPAQVEAACAAAPAPVAPMVVRSRAALDAQRVRELVWLATLAPSGGNCQP
FT                   WRFSWDGKRLRLVHDAARSRSFLDHRDLASWLAFGAAVENVALAAAAMGLDAAVELRPD
FT                   PGDPAAVCDLRFAATGGAAPASVVALAAAIPERVTNRKLAPRAPLARHAHDLLLRVAAE
FT                   VPGAALHLVEDPERLAALGEVLGRGDRLRFLSRTMHREMMGELRWSAEEARATRDGLDV
FT                   ATLELSGADQAGLRVMSSWAAMELVGRLGGGRALEKPAARAMAAASAAGLVSVPEHTRE
FT                   AYFAGGRAMQRVWLQATVLGLAFQPMTPLTYLFARLASGGGEGLTPAEATTLRELRGRL
FT                   DRLFPDARGRGEPMLFRLAVAPPASARALRRGVEEVLEVDPSAETRAGPLRAAPFTSAT
FT                   HRRAG"
     atgcgcggtc cgcaccagct ggagtttcgg gagaccgccc agtcgccgcg gccccgcccc        60
     gccggccctc ccggcttcga gcacgcgccg cccgatccgg accgggtgct gcggcccggc       120
     cacgagggga accggtggcg gccggaggcg ttcgccgcag gcgacccggc ggcgcgcgag       180
     cggctcgccg cgcgcgtcgt cgagggcggc ctcgccgtgc acgacacgct gcgggagcag       240
     ctcgtggagc tcctcgagac ccgcgagccc gcccgggagc tcgagcccgc ggagctgggc       300
     gagcggcttg cggcgcatct cgagggggcg ccgctcgcgc accacggcac ctggttcctc       360
     tacccgtggt cccggcgggt cgtgcacgtg ctgccggagg acgagttccg cgagctccgg       420
     gcgagccgga acaggaacaa gatctcgtcc gaggagcagg agcggctccg cgccctccgg       480
     ctcggcgtca tcgggctctc ggtggggagc gcgagcgcgg tcgccctcgc gatggagcag       540
     gtgggcgggg agctctacct cgcggaccac gaccggctga gcctctcgaa cctgaaccgg       600
     ctccgggccg gcgtgcacga gatcgggctc cccaaggccg tgctcaccgc gcgcgccatc       660
     gccgagctcg atccgtacct gcgcgtgcga ccgttcctgg acgggatcac cgacgggaac       720
     atggacgcgt tccttcgacc cggcgggcgt ccgctcgacc tgctcgtgga ggagtgcgac       780
     gacctctacg tgaaggtgcg ggtgcgggag gcggcgcgcg cgctgcgcat ccccgtgctc       840
     atggagacga gcgaccgggg cctcctcgac gtcgagcgct tcgacctcga gcccgggcgg       900
     cccgtcctcc acggcctcgt cggcgccatc gacgcggagc gcctccgcgg cctcgacacc       960
     tcggagaagg tgcccatcgt gctccgcatc ctcggcgaac ggtcgatctc gccgcgcctg      1020
     gcggcgtcgc tcgtggaggt gaaggccacg ctcaagacct ggccgcagct cgcctcggcc      1080
     gtctcgctcg gcgctgcggt cgtgaccgac gccgcgcgcc gcatcgcgct cggccagctc      1140
     acctcgtccg ggcggttcta cgtggacctc gacgagctcg tgcgcgacgg agcgggggcg      1200
     gcgctgcccg ggctccagga ccccccgccc gcgcaggtcg aagcggcgtg cgccgccgcg      1260
     ccggccccgg tcgcccccat ggtggtgcgg tcgcgcgcgg cgctcgacgc gcagcgcgtc      1320
     cgggagctcg tgtggctcgc cacgctcgcg ccgtccgggg ggaactgcca gccctggcgg      1380
     ttctcttggg acggcaagcg tctccgcctg gtccacgacg ccgcccgctc gcggtcgttc      1440
     ctcgaccacc gcgatctcgc cagctggctc gcgttcggcg ccgccgtcga gaacgtggcg      1500
     ctcgccgcgg ccgcgatggg gctcgacgcc gcggtcgagc tccgcccgga tccgggcgat      1560
     cccgccgcgg tgtgcgatct ccgcttcgcc gcgacgggcg gcgccgcgcc ggcgagcgtc      1620
     gtcgcgctcg cggcggccat cccggagcgg gtcacgaacc gcaagctcgc gccgcgcgct      1680
     ccgctcgccc ggcacgcgca cgacctcctc ctccgcgtcg ccgcggaggt gcccggcgcg      1740
     gcgctgcacc tcgtcgagga cccggagcgg ctcgccgcgc tcggcgaggt gctcgggcga      1800
     ggggaccggc tgcgcttcct ctcgcgcacc atgcatcgcg agatgatggg ggagctccgc      1860
     tggagcgccg aggaggcgcg cgcgacgcgc gacggcctgg acgtcgccac gctcgagctc      1920
     tccggcgcgg atcaggcggg cctgcgcgtg atgtcgtcct gggccgcgat ggagctcgtg      1980
     ggccgcctcg gcggcgggcg cgccctcgag aagccggcgg cgcgggcgat ggcggcggcg      2040
     agcgccgcgg gcctcgtctc cgtgcccgag cacacgcgcg aggcctactt cgcagggggc      2100
     cgggccatgc agcgcgtgtg gctccaggcg acggtcctcg gcctcgcgtt ccagcccatg      2160
     acgccgctca cgtacctctt cgcgcgcctg gcgtccggcg gcggcgaggg gctcacgccg      2220
     gcggaggcca ccacgctgcg cgagctgcgg ggccggctcg accggctgtt ccccgacgcg      2280
     cgggggcggg gggagcccat gctgttccgg ctcgccgtcg cgcccccggc gagcgcgcgc      2340
     gccctgcgcc gcggcgtcga ggaggtgctg gaggtcgatc cgtcggcgga aacgcgggcg      2400
     ggtccgctcc gggcggcgcc gttcacgtcc gcgacgcacc ggcgcgccgg ctga            2454
//

If you have problems or comments...

PBIL Back to PBIL home page