(data stored in ACNUC7421 zone)

EMBL: CP000769.PE261

CP000769.PE261       Location/Qualifiers
FT   CDS_pept        complement(306363..307502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0263"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: ade:Adeh_0241 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: putative
FT                   oxygen-independent coproporphyrinogen III oxidase; PFAM:
FT                   Radical SAM domain protein; HemN domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24481"
FT                   /db_xref="GOA:A7H6Y5"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y5"
FT                   /protein_id="ABS24481.1"
FT                   /translation="MARRFGIYVHFPYCAHRCPYCDFAVTTERPPEGRRYLAALLAELE
FT                   LRAGAFDGLAPVSVYLGGGTPSLWDPDEVAALLAALRARLALPAGAEVTIEANPESTDR
FT                   ARLRAWRAAGVNRVSVGVQSFDAGVLAKLGRRHGPDAAERAIREAAEELGNVSVDLIYG
FT                   ARRSTVEIARADAARAAASGAAHVSAYALTLDPGIMAEEVPLARMRREGRLPLPSDDEV
FT                   AAQAAAIRAALRRAGLRRYEISNFARPGLESAHNRLYWTAESYLGLGAGAYGCARGEAG
FT                   SYRYGNLRDARAYLDAALGRRSPTAEEDRIAPAAERNERMMLGLRTLEGVPLATLSPIQ
FT                   SREADRLVRRRLAVRRRGALVLTSRGMDLHTSIAERLLE"
     atggcgcgcc ggttcggcat ctacgtccac ttcccctact gcgcgcaccg ctgcccgtac        60
     tgcgacttcg cggtcacgac cgagcggccg cccgagggcc gccggtatct cgccgcgctg       120
     ctcgcggagc tggagctgcg cgccggcgcc ttcgacgggc tcgcgccggt gagcgtctac       180
     ctcggcggcg gcacgccgtc gctgtgggat ccggacgagg tcgcggcgct cctcgcggcg       240
     ctgcgcgcgc ggctggcgct gcccgccggg gccgaggtga cgatcgaggc caaccccgag       300
     tccaccgacc gggcgcggct gcgggcctgg cgcgccgcgg gcgtgaaccg cgtgtcggtc       360
     ggcgtgcaat cgttcgacgc gggcgtcctc gcgaagctcg gccgccggca cggcccggac       420
     gcggcggagc gcgcgatccg cgaggcggcc gaggagctcg ggaacgtcag cgtcgacctc       480
     atctacgggg cccggcgctc cacggtggag atcgcccggg ccgacgccgc ccgggcggcg       540
     gcctcgggcg cggcccacgt ctcggcgtac gcgctgacgc tcgaccccgg gatcatggcg       600
     gaggaggtgc ccctcgcgcg catgcgccgc gagggccggc tccccctccc ctccgacgac       660
     gaggtcgccg cgcaggccgc cgccatccgc gccgcgctcc gccgcgccgg gctgcgccgc       720
     tacgagatct cgaacttcgc gcgccccggc ctggagtccg cgcacaaccg cctctactgg       780
     accgccgaga gctacctcgg gctgggcgcc ggcgcctacg gctgcgcgcg cggcgaggcg       840
     ggctcgtacc gctacgggaa cctgcgcgac gcgcgcgcct acctcgacgc ggcgctcggc       900
     cggcggtcgc cgacggcgga ggaggaccgc atcgcgccgg cggcggagcg caacgagcgc       960
     atgatgctcg ggctccgcac gctcgagggc gtgccgctcg cgacgctgtc tccgatccag      1020
     tcgcgcgagg cggaccggct cgtgcggcgg cgcctcgccg tccggcggcg cggcgcgctc      1080
     gtcctcacct cgcgtggcat ggacctccac acctcgatcg cggagcggct gctcgagtga      1140
//

If you have problems or comments...

PBIL Back to PBIL home page